DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and HERC5

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_011530324.2 Gene:HERC5 / 51191 HGNCID:24368 Length:1100 Species:Homo sapiens


Alignment Length:420 Identity:115/420 - (27%)
Similarity:194/420 - (46%) Gaps:65/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 QGLLEGADLLPKYRRDLVGK--LRALRTELQ-----TMQPQSGHCRLEVSRNEIFEESYRLIMKM 722
            |.|||   :|.|..|....|  ||:...|.:     .::|...   |.|.||.:.|:....:.:.
Human   719 QALLE---MLKKLHRSKKHKAYLRSAAIEEERESEFALRPTFD---LTVRRNHLIEDVLNQLSQF 777

  Fly   723 RAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSG---- 783
            ..:|:||.|.|.|.||.|.|.|||.:|:.:.|..||:.|:||:|.|           |:..    
Human   778 ENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMY-----------PEGASCMW 831

  Fly   784 --VNP--DHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTW 844
              |.|  :...|| |.|...|:::|:.:..:..|....:|:||::..:|.|::.:.|||.::|..
Human   832 FPVKPKFEKKRYF-FFGVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQT 895

  Fly   845 MLESNISGIIESTFSVENNSFGALVVH------ELKPGGASIPVTEENKREYVKLYVNYRFMRGI 903
            :|:.. ....|..|.:..|      ||      .|.|.|:||.|.:.|||:||..|:||.|...:
Human   896 LLDDE-GDNFEEVFYIHFN------VHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSV 953

  Fly   904 EQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLKHCTNET-TQVLWFWQ 967
            :..:...::||.::....:::.|...||:.||.|.:..|...:..|.|.:...|.: ..::.||:
Human   954 KAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWK 1018

  Fly   968 VVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVP---TQNLP-KAHT 1028
            .....:.|.:.:.|.|:||:.|:.::.              |..:.:|...|   .:..| :|.|
Human  1019 AFHKLTLEEKKKFLVFLTGTDRLQMKD--------------LNNMKITFCCPESWNERDPIRALT 1069

  Fly  1029 CFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            ||:.:.||.|.|.:.:.:.|.:|:....||
Human  1070 CFSVLFLPKYSTMETVEEALQEAINNNRGF 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 101/374 (27%)
HECTc 726..1058 CDD:214523 96/350 (27%)
HERC5XP_011530324.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.