DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Smurf and ASCC1

DIOPT Version :9

Sequence 1:	NP_001261061.1	Gene:	Smurf / 36999	FlyBaseID:	FBgn0029006	Length:	1061	Species:	Drosophila melanogaster
Sequence 2:	NP_001185728.1	Gene:	ASCC1 / 51008	HGNCID:	24268	Length:	400	Species:	Homo sapiens

Alignment Length:	96	Identity:	25/96 - (26%)
Similarity:	39/96 - (40%)	Gaps:	31/96 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 RNG--THKVRITILCARNLARKDLFRLPDPFA--------KVQV-DGTGQVYSTEISKSSLDPKW 62
            |||  :.:.||.:|.       |.||...||.        :|:| :|..:.....::|.|:|
Human   138 RNGVISARTRIDVLL-------DTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMD--- 192

  Fly    63 NAHYDLFLGIGDAITITVWNQRKIHKGSGFL 93
              |     |:..:|   ..|.:|:|...|.|
Human   193 --H-----GVDSSI---FQNPKKLHLTIGML 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Smurf	NP_001261061.1	C2_Smurf-like	14..135	CDD:176028	22/89 (25%)
		WW	169..198	CDD:278809
		WW	514..546	CDD:197736
		WW	562..594	CDD:197736
		HECTc	702..1058	CDD:238033
		HECTc	726..1058	CDD:214523
ASCC1	NP_001185728.1	Required for interaction with ASCC3. /evidence=ECO:0000269\|PubMed:29997253	1..53
		vigilin_like_KH	99..148	CDD:239087	3/9 (33%)
		PLN00108	157..370	CDD:177724	16/70 (23%)
		AKAP7_NLS	161..349	CDD:287446	15/66 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900