DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Magi1

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_038964101.1 Gene:Magi1 / 500261 RGDID:1586025 Length:1491 Species:Rattus norvegicus


Alignment Length:407 Identity:90/407 - (22%)
Similarity:136/407 - (33%) Gaps:112/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 QNYVNGNAQNGSTSGNGSGQAAQPQSASNGWTQEDAATTTSPSTTTSPPRHSQSP---------- 410
            ::::|...|.||           |........:::......|.||.| ||..:.|          
  Rat   113 RHFLNQRFQKGS-----------PDHELQQTIRDNLYRHAVPCTTRS-PREGEVPGVDYSFLTVK 165

  Fly   411 ------------------------PTPNISPPAS--VTPSANGNVHSPNANSTPAGSGGGSRSYT 449
                                    |.|...|.:.  :|..|..::.|.:..|||.    .::||.
  Rat   166 EFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPK----RTKSYN 226

  Fly   450 AATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRYASAAIAAANQAARPFLD 514
            ..   |.:....:..:.||......||      .|:..|.......:.|:.....::..|.|..|
  Rat   227 DM---QNAGIVHTENEEEEDVPEMNSS------FTADSGDQDEPTLQEATLPPVNSSALAAPITD 282

  Fly   515 -------------------LPPGYEMRTTQQGQVYFYHIPTGVSTWHDPR-----------IPRD 549
                               ||..:||..|:.|:|||....|..::|.|||           ...|
  Rat   283 PSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDD 347

  Fly   550 FDTQHL-TLDAIGPLPSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPPTSAA 613
            .:..|. .||:...||:|||:.:.....||:|||.||.||:.:|.|.....:.:.:.........
  Rat   348 EEGVHTEELDSELELPAGWEKIEDPVYGVYYVDHINRKTQYENPVLEAKRKRQLEQQQQQQQHQQ 412

  Fly   614 NAGTPAPPSATPATPSAAAAVPPQAT--PASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPK 676
            ....|.||.....|...|:.|||.|.  |.||..|.          |..|      |:|.....:
  Rat   413 QPQQPQPPQPEEWTEDHASVVPPVAPSHPPSNPEPA----------REAP------LQGKPFFTR 461

  Fly   677 YRRDLVGKLRALRTELQ 693
            ...:|.||.  :.|:|:
  Rat   462 NPSELKGKF--IHTKLR 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 15/61 (25%)
WW 562..594 CDD:197736 15/31 (48%)
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
Magi1XP_038964101.1 NK 122..293 CDD:418433 32/195 (16%)
WW 302..331 CDD:395320 11/28 (39%)
WW 362..393 CDD:197736 15/30 (50%)
PDZ 469..555 CDD:214570 3/10 (30%)
PDZ 640..723 CDD:214570
MAGI_u5 724..806 CDD:406953
PDZ_signaling 847..922 CDD:238492
PDZ_signaling 996..1091 CDD:238492
PDZ 1152..1234 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.