DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and bag3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:247 Identity:60/247 - (24%)
Similarity:87/247 - (35%) Gaps:83/247 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 PLPSGWEQR-KTASGRVYFVDHNNRTTQFTDPR------------LSGSILQ------------- 600
            |||.|||.: ...:|..:|||||||||.:.|||            :|....|             
Zfish     6 PLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRHDTKKIFSNGPSMSPETPQDMHKTFINEMRQP 70

  Fly   601 MIRRGTVP----------------------PTSAAN----AGTPAPPSATPATPSAAAAVPPQAT 639
            |:|:|.:|                      |....|    ..||:|..|....|.:....|.:| 
Zfish    71 MLRQGYIPIPVCHENPEPRLQQYPSFSYIHPAVQQNLRTDGRTPSPTPAAHCRPRSPVQTPSEA- 134

  Fly   640 PASNATPTTLTTTTNPP---HRIVPDLPQ-------GLLEGADLLPKYRRDLVGKLRALRTELQT 694
             .|:.:||:.......|   |:.:..|.|       ||..|...:|.......|   .|.::|. 
Zfish   135 -CSSCSPTSHGPEGYQPQGTHQQISGLHQQPRSSNTGLRAGYIPIPVIHEGAGG---VLPSQLS- 194

  Fly   695 MQPQSGHCRLEVSRNEIFEESYRL-IMKMRAKD-------MRKRLMVKFKGE 738
               ||.|    .:|.:|:.|...: |.:.||..       .:..:|.:..||
Zfish   195 ---QSSH----PTREKIYREQVPIQIQQNRAASPIQVPLRAQSPVMAQIMGE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736 19/44 (43%)
HECTc 702..1058 CDD:238033 9/45 (20%)
HECTc 726..1058 CDD:214523 3/20 (15%)
bag3NP_001003533.1 WW 6..38 CDD:197736 17/31 (55%)
BAG 358..432 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.