DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Herc4

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:369 Identity:119/369 - (32%)
Similarity:195/369 - (52%) Gaps:22/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 PQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNP 761
            |.|....|.|:|..:.::|.|.:......|::|.|.:||.|||..|.|||.:|:..||.:::|:|
  Fly   710 PISQFIVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDP 774

  Fly   762 QYGLF-QYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKP 825
            :||:| :|.:.   .|....|.....::: || .:|...|:|:::...::..|....:|:||.||
  Fly   775 KYGMFKEYEQS---RLLWFADLTFETENM-YF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKP 834

  Fly   826 ITLGDIEGVDPDLHRSLTWMLE---SNISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENK 887
            :.|.|:..:.|....|:..:|:   .:...:.:.||.:..:.||......|||.|..|.||.||:
  Fly   835 VDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENR 899

  Fly   888 REYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRL 952
            :|:|.|||::.|.:.:|..:.|..|||.::....::..|...||..|:.|....|....::|...
  Fly   900 QEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEY 964

  Fly   953 KH-CTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTA 1016
            :. .|:....:.|||:|:...|...:...|.|:|||.|:|:||.:||:          .||..|.
  Fly   965 REGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALK----------LTIQPTP 1019

  Fly  1017 DVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGFAV 1060
            |  .:.||.||||||.:|||.|:|.:.|..||.||:::|.||::
  Fly  1020 D--ERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 115/360 (32%)
HECTc 726..1058 CDD:214523 110/336 (33%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 116/361 (32%)
HECTc 739..1059 CDD:214523 110/336 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.