DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and CG3356

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:373 Identity:114/373 - (30%)
Similarity:194/373 - (52%) Gaps:37/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKG-----EEGLDYGGVAREWLHLLSREMLNPQY 763
            :.|.|:.::|::|..:......|:|.:..::|..     |.|:|.|||.||:|..|.:...:|..
  Fly   766 ITVRRSHLYEDAYDKLRPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNR 830

  Fly   764 GLFQYSRDDHYTLQINPD-SGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNK--P 825
            |.|..:.|:  .|..||: :.:..|:..:::|:||.||.:::....::......|..:|..|  .
  Fly   831 GFFMVTTDN--KLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSD 893

  Fly   826 ITLGDIEGVDPDLHRSLTWMLESNISGIIES---TFSVENNSFGALVVHELKPGGASIPVTEENK 887
            :.:..:..:||:|:|:|.::  .:.||.:..   .|:|.::|.|...:.||||.|.|||||..|:
  Fly   894 VDIHQLASLDPELYRNLLYL--KDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNR 956

  Fly   888 REYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGIS-SIDVNDWRNNTR 951
            .||::|..:|:....|.:...|.:||...::|...|..|..:||:::|.|.. .||:.|.:    
  Fly   957 IEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLK---- 1017

  Fly   952 LKHC------TNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLF 1010
             |||      :.|...::.||:|:|.:....|.:||:|||..||.||.||:.|.       |..|
  Fly  1018 -KHCEYGGEFSPEHPSIVTFWEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDLD-------PPFF 1074

  Fly  1011 TIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
             |..|.|:  :.||.|.||.|.:.|||::|.:.:.:||..|::...||
  Fly  1075 -IQNTGDM--ERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 112/371 (30%)
HECTc 726..1058 CDD:214523 108/349 (31%)
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 114/373 (31%)
HECTc 788..1119 CDD:214523 108/349 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.