DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Yap1

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_006242550.1 Gene:Yap1 / 363014 RGDID:1306035 Length:491 Species:Rattus norvegicus


Alignment Length:596 Identity:133/596 - (22%)
Similarity:199/596 - (33%) Gaps:198/596 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PKHQTNGHAPPE--------STPTSPTGQQ-NYVNGNAQNGSTSGNGSGQAAQPQSASNGWTQED 390
            |:....|.|||.        :.|..|.|.| .:|.|:::                      |..:
  Rat     9 PQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSE----------------------TDLE 51

  Fly   391 AA--TTTSPSTTTSP---PRHSQSPPTPNISPPASVTPSANGNVHSPNANSTPAGSGGGSRSYTA 450
            |.  ...:|.|...|   |...:..|.....||   .|.:    ||..| ||.||:.|      |
  Rat    52 ALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPP---EPKS----HSRQA-STDAGTAG------A 102

  Fly   451 ATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRYASAAIAAANQAARPFLD- 514
            .||      :..|.....:|.:..:...|.:|..||            .||..||....:...: 
  Rat   103 LTP------QHVRAHSSPASLQLGAGTLTASGVVSG------------PAATPAAQHLRQSSFEI 149

  Fly   515 -----LPPGYEMRTTQQGQVYFYHIPTGVSTWHDPR--------IPRDFD---TQHLTLDAIGPL 563
                 ||.|:||..|..||.||.:.....:||.|||        :|....   .|.|...|.|||
  Rat   150 PDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQTLMNSASGPL 214

  Fly   564 PSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPPTSAANAGTPAPPSATPATP 628
            |.||||..|..|.||:::|.|:||.:.||||.                                 
  Rat   215 PDGWEQAMTQDGEVYYINHKNKTTSWLDPRLD--------------------------------- 246

  Fly   629 SAAAAVPPQATPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKYRRDLVGKLRALRTELQ 693
                   |:...|.|...|.......|| .:.|..|||.:.|            |.....:.::|
  Rat   247 -------PRFGKAMNQRITQSAPVKQPP-PLAPQSPQGGVLG------------GGSSNQQQQIQ 291

  Fly   694 TMQPQSGHCRLEVSRNEIFE----ESYRLIMKMRA-----KDMRKRLMVKFKGEEG-----LDYG 744
            ..|.|....||.:.:.|:|.    ::.|.|....|     :::..|..:....::|     :...
  Rat   292 LQQLQMEKERLRLKQQELFRQVRPQAIRNINPSTANAPKCQELALRSQLPSLEQDGGTQNAVSSP 356

  Fly   745 GVAREWLHLLSREMLNP--QYGLFQYSRDD---------HYTLQINPDSGVN------------- 785
            |:.:| |..::....:|  ..|.: :|||:         .|::...||..:|             
  Rat   357 GMTQE-LRTMTTNSSDPFLNSGTY-HSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQ 419

  Fly   786 ----------PDHLSYFHFVGRTLGIAVFHGHC--LDGGFTTPFYKQLLNKPITLGDIEGV---- 834
                      ||:|.  ...|..:.:....|..  ::|....|..::.|:..|.  |:|.|    
  Rat   420 STLPSQQSRFPDYLE--ALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEIL--DVESVLAAT 480

  Fly   835 DPDLHRSLTWM 845
            ..|....|||:
  Rat   481 KLDKESFLTWL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 15/45 (33%)
WW 562..594 CDD:197736 17/31 (55%)
HECTc 702..1058 CDD:238033 37/198 (19%)
HECTc 726..1058 CDD:214523 30/165 (18%)
Yap1XP_006242550.1 WW 156..185 CDD:238122 12/28 (43%)
WW 213..245 CDD:197736 17/31 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.