DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Herc6

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:374 Identity:101/374 - (27%)
Similarity:179/374 - (47%) Gaps:53/374 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQY 768
            |:|.|:.:.|::.|.:.:....|:||.|.|.|..|...:.|||:.|:.|.:..||.:|:|.:|.|
  Rat   684 LKVRRSHLVEDTLRQLRQAEDFDLRKTLSVGFINEIRPEGGGVSSEFFHCIFEEMTDPKYEMFMY 748

  Fly   769 SRDDHYTLQINPDSG------VNP--DHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKP 825
                       |::|      |||  :...||.| |...|:::.:.:.::..|....||:||.:.
  Rat   749 -----------PENGSNMWFPVNPKFEKSRYFLF-GILCGLSLNNLNVINLSFPLALYKKLLEQK 801

  Fly   826 ITLGDIEGVDPDLHRSLTWMLESNISGIIEST---FSVENNSFGALVVHELKPGGASIPVTEENK 887
            .:|.|::.:...|.|:|..:|... :|:||..   ||:..:....    :|.|.|.|:||.|.||
  Rat   802 PSLEDLKDLSLLLGRNLQEVLNCE-AGVIEELHMYFSIYWDQRDV----DLIPDGISVPVNETNK 861

  Fly   888 REYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRL 952
            |:||...|:|.|...|:..:....:||.::.....:|.|...||...|.|..:.|...:.||::.
  Rat   862 RDYVSKCVDYIFNISIKTIYDEFHRGFYKVCNRDSIRHFQPEELMAAIIGNPTCDWKQFENNSKY 926

  Fly   953 KHCTNET-TQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQG-------FRALQGSTGAVGPRL 1009
            ::..::: ..:|.||:.....:.:.:.:.|.|:||..|:.::|       ||.         |.:
  Rat   927 ENGYSKSHPTILLFWKAFHELTLDEKKKFLLFLTGCDRLHVKGLQNEGIRFRC---------PEV 982

  Fly  1010 FTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            |:        .::.|::.||.:.:|||.|.|.:.:.:.|..|:....||
  Rat   983 FS--------ERDNPRSLTCHSILDLPKYSTMRRMKEALQVAINNNKGF 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 99/372 (27%)
HECTc 726..1058 CDD:214523 94/350 (27%)
Herc6XP_008761185.1 RCC1 39..88 CDD:278826
RCC1 92..141 CDD:278826
RCC1 144..194 CDD:278826
RCC1_2 182..210 CDD:290274
RCC1_2 236..265 CDD:290274
RCC1 252..299 CDD:278826
HECTc 682..1023 CDD:238033 99/372 (27%)
HECTc 706..1023 CDD:214523 94/350 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.