DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and CG4238

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:375 Identity:116/375 - (30%)
Similarity:179/375 - (47%) Gaps:44/375 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQY 768
            |:|.|.:|.|.|.:.:......|......|.|:||:|:|:||:.|||..|:...:.:.:.|||..
  Fly   615 LKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGGLFCT 679

  Fly   769 SRDDHYTLQINPDSGVNPDH--LSYFHFVGRTLGIAVFHGHCLDGG---------FTTPFYKQLL 822
            ..|.|..| ::|:. ..|.|  |.:|.|.|:.:|..:|....  ||         |:..|..||:
  Fly   680 FHDKHQAL-VHPNP-TRPAHLKLKHFEFAGKMVGKCLFESAL--GGTYRQLVRARFSRSFLAQLI 740

  Fly   823 NKPITLGDIEGVDPDLHRS-LTWMLESNISG-------IIESTFSVENNSFGALVVHELKPGGAS 879
            ...:.....|..||||:.| :.::|::::..       .:|..:...:......:  ||.|.||.
  Fly   741 GLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTI--ELIPNGAK 803

  Fly   880 IPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVN 944
            ..||...|.:|:......|....::.:..:..||...:||.:||..|||.||||::.|.....::
  Fly   804 TRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENELELLMCGTGEYSIS 868

  Fly   945 DWRNNTRLKHCTN----ETTQVL-WFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGA 1004
            |::.:    |..|    |..:|| |||..|.::|....||||||.||.|::|..||:.|      
  Fly   869 DFKAH----HIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQEL------ 923

  Fly  1005 VGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQAVEE 1054
             .|:   ..:||.....|||.||||||::.||.||:|:.....|..|:.|
  Fly   924 -NPQ---FQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISE 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 116/375 (31%)
HECTc 726..1058 CDD:214523 110/353 (31%)
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 116/375 (31%)
HECTc 642..974 CDD:214523 109/348 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.