DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Magix

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:284 Identity:66/284 - (23%)
Similarity:84/284 - (29%) Gaps:112/284 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TVWNQRKIHKGSGFLGCVRIPAFNIQSLKGAGFQRLD--LGKLSPDDDELVRGQIIISLLSKDGP 141
            |:...|..|:.|...|....|...||: |.:...||.  .|:.|.   |||||.....|....|.
  Rat    86 TLVEHRPQHQRSDTQGPRMEPLPVIQN-KASYASRLPQATGRFSV---ELVRGPAGFGLTLSGGR 146

  Fly   142 S-SGN-PLAIVGPSGDVRGPSEDDSSEDSLPEGWEERRTDNGRVYYVN--------HATKSTQWD 196
            : ||| |||:.|...|  ||::...   .|..|        ..|.|:|        || ::.:|.
  Rat   147 NVSGNVPLAVCGLLKD--GPAQRCG---HLQAG--------DLVLYINGQSTRGLTHA-QAVEWI 197

  Fly   197 RPRQPGVVGSSHATSPQQRHNTHNGNSGDRQAPAGPTRSTTCTNLMNNGHRSRDLSVTASDERRH 261
            |      .|........||....||:   |....|            .||:..|   ...|.|  
  Rat   198 R------TGGPRLCLVLQRPQEMNGS---RSKEVG------------GGHQKTD---RIPDPR-- 236

  Fly   262 STEILSSVGKENTSPTTPVSATTTPGKKTSSSNSSSAGGRTLEQRPTNEPATPTSSTTSASVRLH 326
                                                 |||.:|.|.|..|.              
  Rat   237 -------------------------------------GGRMMESRGTISPV-------------- 250

  Fly   327 SNDNHVKTPKHQTNGHAPPESTPT 350
               :|  .||.:|.....|||..|
  Rat   251 ---HH--RPKTRTGPGPSPESVAT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028 18/57 (32%)
WW 169..198 CDD:278809 8/36 (22%)
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PDZ_signaling 127..209 CDD:238492 28/104 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267 22/128 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.