DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and Hectd3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_008762291.1 Gene:Hectd3 / 313525 RGDID:1309823 Length:861 Species:Rattus norvegicus


Alignment Length:449 Identity:110/449 - (24%)
Similarity:178/449 - (39%) Gaps:120/449 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 LLPKYRRDLVGK-LRALRTELQTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMR-------- 728
            ||.:.|..||.: ||...:...:..|     ||.::|        ||.|:.||...|        
  Rat   447 LLSRQRPSLVTQCLRDSESSKPSFMP-----RLYINR--------RLAMEHRACPSRDPACKNAV 498

  Fly   729 -----KRLMVKFKGEEGLDYGGVARE---WLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVN 785
                 :.|....|.|:.|||....|.   |......|.:..|.|.|:.|..| .:.::.|.|...
  Rat   499 FTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGGGFRDSLAD-MSEELCPSSADT 562

  Fly   786 PDHLSYF-----------------------------HFVGRTLGIAVFHGHCLDG---------G 812
            |..|.:|                             .::|:.:|.|      |.|         |
  Rat   563 PVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEWIGQLMGAA------LRGKEFLVLALPG 621

  Fly   813 FTTPFYKQLLNKPITLG-DIEGVDPDLHRSLTWMLESNISGIIESTFSVENNSFGALV------- 869
            |.   :|||..:.::.. |...||..|.:.|..|     .|:.:.||..:   ||..:       
  Rat   622 FV---WKQLSGEEVSWSKDFPAVDSVLVKLLEVM-----EGVDKETFEFK---FGKELTFTTVLS 675

  Fly   870 ---VHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDEREL 931
               |.||.|||..|.|..|::..:::|....| :...::|..|:|.|..:::|..:|.....:||
  Rat   676 DQQVVELIPGGTGIVVGYEDRLRFIQLVQKAR-LEESKEQVAAMQAGLLKVVPQAVLDLLTWQEL 739

  Fly   932 ELVIGGISSIDVNDWRNNTRLKHCTNETTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFR 996
            |..:.|...:.|:..|..||.:......|:|.:||:.:.::::|.|:|.|:||||.||:|.:   
  Rat   740 EKKVCGDPEVTVDALRKLTRFEDFEPSDTRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPAR--- 801

  Fly   997 ALQGSTGAVGPRLFTIHLTAD----VPTQNLPKAHTCFNRIDLPPYETYQLLCDKLTQA 1051
                           |::..|    ..|..||::.||.:.:.||.|.:.::..:||..|
  Rat   802 ---------------IYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYA 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 102/419 (24%)
HECTc 726..1058 CDD:214523 94/395 (24%)
Hectd3XP_008762291.1 APC10-HECTD3 238..371 CDD:176487
HECT 579..845 CDD:395507 73/301 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.