DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and WWC1

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_011532787.1 Gene:WWC1 / 23286 HGNCID:29435 Length:1185 Species:Homo sapiens


Alignment Length:410 Identity:89/410 - (21%)
Similarity:138/410 - (33%) Gaps:126/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RPFLDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTL-DAIG-PLPSGWEQRKT 572
            ||.|.||.|:|......|:||:.......::|.|   |||..|:.||. |.|. .||.|||:...
Human     3 RPELPLPEGWEEARDFDGKVYYIDHTNRTTSWID---PRDRYTKPLTFADCISDELPLGWEEAYD 64

  Fly   573 ASGRVYFVDHNNRTTQFTDPRLSGSILQMIRRGTVPPTSAANAGTPAPPSATPATPSAAAAVPPQ 637
            .....||:|||.:|||..|||:                                           
Human    65 PQVGDYFIDHNTKTTQIEDPRV------------------------------------------- 86

  Fly   638 ATPASNATPTTLTTTTNPPHRIVPDLPQGLLEGADLLPKYRRDLVGKLRALRTELQTMQPQSGHC 702
                                       |...|...:|..|   ||....||..:.:..|      
Human    87 ---------------------------QWRREQEHMLKDY---LVVAQEALSAQKEIYQ------ 115

  Fly   703 RLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYG--------GVAREWLHLLSREML 759
             ::..|.|:.::.|:.:..:....:..::.:.........|.        ..|:..::.|.|||:
Human   116 -VKQQRLELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMV 179

  Fly   760 NPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNK 824
            :.|:.| |:......||: ..|..::....||                .||.........:.:.|
Human   180 HLQHEL-QFKERGFQTLK-KIDKKMSDAQGSY----------------KLDEAQAVLRETKAIKK 226

  Fly   825 PITLGDIEGVDPDLHRSLTWMLESNI-------SGIIESTFSVENNSFGA----LVVHELKPGGA 878
            .||.|:.|  ..||.:||. ||:...       |.:..|:.|:|::||..    |.|........
Human   227 AITCGEKE--KQDLIKSLA-MLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDVSSQTDISG 288

  Fly   879 SIPVTEENK-REYVKLYVNY 897
            |..:...|: .|.|:|.:.|
Human   289 SFGINSNNQLAEKVRLRLRY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 9/31 (29%)
WW 562..594 CDD:197736 15/31 (48%)
HECTc 702..1058 CDD:238033 44/216 (20%)
HECTc 726..1058 CDD:214523 41/192 (21%)
WWC1XP_011532787.1 WW 9..39 CDD:238122 9/32 (28%)
WW 55..84 CDD:278809 13/28 (46%)
ALDH-SF 429..>481 CDD:299846
C2_Kibra 721..844 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.