DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and yap-1

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001369894.1 Gene:yap-1 / 181267 WormBaseID:WBGene00008748 Length:442 Species:Caenorhabditis elegans


Alignment Length:292 Identity:64/292 - (21%)
Similarity:94/292 - (32%) Gaps:119/292 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 RLHSNDNHVKTP-----KHQ-----TNGHAP----PESTPTSPTGQQNYVNGNAQNGSTSGNGSG 374
            :...|.|..|.|     .||     ::.|:|    .||:.|:.:...:.|:..|...:.      
 Worm    43 KYEKNQNQKKNPLPSSYYHQKRNPGSSAHSPYGSVDESSRTAVSPAMDMVSNQAPIHTR------ 101

  Fly   375 QAAQPQ---SASNGWTQEDAATTTSPSTTTSPPRHSQS----PPTPNISPPASVTPSANGNVHSP 432
            |.:.|.   |.:||   :.:||...||......:||:|    |.|...||..|...|.:   |..
 Worm   102 QVSAPNLHTSVNNG---QSSATVPHPSHHNVHHQHSKSVSALPMTIGYSPVPSHVKSVS---HEA 160

  Fly   433 NANSTPAGSGGGSRSYTAATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRY 497
            |              |:.|...:..|::...||..|.|                           
 Worm   161 N--------------YSYAGLSEIPQQQGMMQQNREKS--------------------------- 184

  Fly   498 ASAAIAAANQAARPFLDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTLDAIGP 562
                 .:.:...|||:          |.|                        |.:.|      |
 Worm   185 -----LSLDPMRRPFM----------TPQ------------------------DVEQL------P 204

  Fly   563 LPSGWEQRKTASGRVYFVDHNNRTTQFTDPRL 594
            :|.|||....:.|..||.|||::||.:.||||
 Worm   205 MPQGWEMCYDSDGVRYFKDHNSKTTTWDDPRL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 2/31 (6%)
WW 562..594 CDD:197736 15/31 (48%)
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
yap-1NP_001369894.1 WW 206..236 CDD:238122 14/29 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.