DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and herc3

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_002938676.3 Gene:herc3 / 100488790 XenbaseID:XB-GENE-968537 Length:1050 Species:Xenopus tropicalis


Alignment Length:408 Identity:120/408 - (29%)
Similarity:203/408 - (49%) Gaps:43/408 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 DLVGKLRALRT--ELQ-----------------TMQP---QSGHCRLEVSRNEIFEESYRLIMKM 722
            |...|.:.|:|  |||                 |:.|   ::....|.|.|..:..::.|.:...
 Frog   658 DAQAKTKMLQTDAELQMQVAINGANLQNVFMLLTLDPMLVKNPFLVLHVRRTSLVADALRELSIY 722

  Fly   723 RAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPD 787
            ...|::|.|.|.|.|||.:|.|||.:|:..||.:|:|||.||:|...:|.: .|..:....|  :
 Frog   723 SDIDLKKPLKVIFDGEEAVDDGGVTKEFFLLLLKELLNPIYGMFTVYQDSN-LLWFSDICFV--E 784

  Fly   788 HLSYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWML---ESN 849
            | ::||.:|...|:|:::...:|..|....||:|||...||.|::.:.|...|||..:|   |.:
 Frog   785 H-NWFHLIGIMCGLAIYNFTVVDLYFPLALYKKLLNVQPTLEDLKELSPTEGRSLQELLDYPEDD 848

  Fly   850 ISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGF 914
            :..:....|::...|:|......|..||..|.||::|::::|..||||.|.:.:::.:.|...||
 Frog   849 VDDVFCLNFTICRESYGLAERRPLVAGGDHITVTKDNRQQFVDAYVNYVFNQSVQEWYEAFSTGF 913

  Fly   915 CELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLK--HCTNETTQVLWFWQVVESYSSEMR 977
            .::....:|..|...||..::.|.::.:..:...|...|  :.|...| |..||:....:..|.:
 Frog   914 LKVCGGKILELFQPSELRSMVVGSNNYNWQELEENAIYKGDYSTAHPT-VRMFWETFHDFPLEKK 977

  Fly   978 ARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQ 1042
            .:.|.|:|||.|:|:.|..:|         |:....:::.  ..:||.||||:|.:|||.|.:.:
 Frog   978 KKFLLFLTGSDRIPIYGMSSL---------RIIIQSISSG--EDHLPVAHTCYNLLDLPKYSSKE 1031

  Fly  1043 LLCDKLTQAVEETCGFAV 1060
            .|..:||||::...||::
 Frog  1032 TLRRRLTQAIDHYEGFSL 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 109/360 (30%)
HECTc 726..1058 CDD:214523 105/336 (31%)
herc3XP_002938676.3 RCC1 3..49 CDD:395335
ATS1 44..353 CDD:227511
HECTc 702..1048 CDD:238033 110/361 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.