DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smurf and herc5.4

DIOPT Version :9

Sequence 1:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_005160166.1 Gene:herc5.4 / 100148091 ZFINID:ZDB-GENE-090311-7 Length:995 Species:Danio rerio


Alignment Length:361 Identity:95/361 - (26%)
Similarity:165/361 - (45%) Gaps:32/361 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLHLLSREMLNPQYGLFQY 768
            |.::|..:..::.: .::.........|.|.|.||:|:|..|::.|:..|:|:..:         
Zfish   658 LHINRESVLTDTLQ-YLRQNTHSFMHPLQVAFIGEDGIDMRGLSAEFFSLISKSFI--------- 712

  Fly   769 SRDDHYTLQINPDSGV--NPDHL---SYFHFVGRTLGIAVFHGHCLDGGFTTPFYKQLLNKPITL 828
             ..|...|:::..|.|  ||.|.   ..|:::|...|:|:::.|.::..|....:|:||.:..:|
Zfish   713 -EWDKKILEVHESSLVWFNPHHTRGNKNFYYLGVICGMALYNRHHINIDFPLALFKKLLQQKPSL 776

  Fly   829 GDIEGVDPDLHRSLTWMLESNISGIIESTFSVENNSFGALVVHELKPGGASIPVTEENKREYVKL 893
            .|:|.:.|...|||..:||.:    .|...::::..| .....||.|.|:.|.|.:.|:::||.|
Zfish   777 DDLEELSPVEARSLKNLLEED----EEEVVNLQHLDF-TCKGQELVPNGSQIQVNKVNRQKYVDL 836

  Fly   894 YVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDERELELVIGGISSIDVNDWRNNTRLKHCTNE 958
            ||:..|.:.::.||....:||.:..|......|...||:.::.|....:..:.:.:...:.|:..
Zfish   837 YVDLEFNKSVKTQFEQFTRGFSKGCPLDAWTMFHPEELQELLHGSPQYNWKELQQSASYEGCSAS 901

  Fly   959 TTQVLWFWQVVESYSSEMRARLLQFVTGSSRVPLQGFRALQGSTGAVGPRLFTIHLT-ADVPTQN 1022
            ...:..||.|....|.|.:.:.|.|:.|:.|||          .|.:..|...|..| ...|..:
Zfish   902 DELIKNFWTVFFELSEENKKKFLMFLYGTERVP----------AGGLSKRALKISQTDCPDPDDH 956

  Fly  1023 LPKAHTCFNRIDLPPYETYQLLCDKLTQAVEETCGF 1058
            ||:|.|||.|:.||.|.....|.|||..|:.....|
Zfish   957 LPEAQTCFERLVLPKYSDINTLHDKLIHAINSCAVF 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736
WW 562..594 CDD:197736
HECTc 702..1058 CDD:238033 94/359 (26%)
HECTc 726..1058 CDD:214523 92/337 (27%)
herc5.4XP_005160166.1 RCC1_2 117..146 CDD:290274
RCC1 133..183 CDD:278826
RCC1 186..235 CDD:278826
RCC1 239..286 CDD:278826
RCC1 294..343 CDD:278826
HECTc 658..993 CDD:294058 95/361 (26%)
HECTc 682..992 CDD:214523 92/334 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.