DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment icln and clns1a

DIOPT Version :9

Sequence 1:NP_611237.2 Gene:icln / 36997 FlyBaseID:FBgn0029079 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_571499.2 Gene:clns1a / 30699 ZFINID:ZDB-GENE-990415-259 Length:249 Species:Danio rerio


Alignment Length:232 Identity:71/232 - (30%)
Similarity:107/232 - (46%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLIMRVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGI 65
            |||:..:.||..|:..........|..|.:|.||:::|:..|||.... ..|..:|:..:|||.|
Zfish     1 MVLLKSLPPPSEGVRLQQAETTAVLDGKRLGLGTLFVAEAQLSWFDGS-GMGFCLEYPTISLHAI 64

  Fly    66 SSN----PRKCIYFMLDHKVEWNGVYGDPPQQAVNGRNGGGSEAEVDEGNGS----DEHDEDDNF 122
            |.:    |.:.:|.|::.|::                         |||..:    |..:||:|.
Zfish    65 SRDLSAFPEEHLYVMVNAKLD-------------------------DEGEAAPLEKDPDEEDENE 104

  Fly   123 EDAVDEQFGEVTECWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLE---DEA 184
            ||:..|..||:||...:|.|...::.|:|||..|||||||..::||||.|   |..|.|   :||
Zfish   105 EDSDSEGSGEITEIRFVPSDKAALEPMFSAMCDCQALHPDPDDADSEDDD---DYEGEEYDVEEA 166

  Fly   185 MEEDDALTLG--------RNGVQNLSLDDDE--ERFE 211
             |::.|...|        ..|:.:|:.:...  ||.|
Zfish   167 -EQEQAQAHGDIPSFYTYEEGLSHLTAEGQATLERLE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iclnNP_611237.2 Voldacs 33..189 CDD:281511 55/166 (33%)
clns1aNP_571499.2 Voldacs 33..>143 CDD:281511 41/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581501
Domainoid 1 1.000 77 1.000 Domainoid score I8835
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508796at2759
OrthoFinder 1 1.000 - - FOG0006470
OrthoInspector 1 1.000 - - oto38677
orthoMCL 1 0.900 - - OOG6_103509
Panther 1 1.100 - - LDO PTHR21399
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.