DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment icln and icl-1

DIOPT Version :9

Sequence 1:NP_611237.2 Gene:icln / 36997 FlyBaseID:FBgn0029079 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_503306.1 Gene:icl-1 / 178583 WormBaseID:WBGene00001564 Length:968 Species:Caenorhabditis elegans


Alignment Length:251 Identity:46/251 - (18%)
Similarity:71/251 - (28%) Gaps:113/251 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VLIMRVSPPEHGLL-YTANN-----IKLKLGDKV---VGEGTVYIAQNTLSWQPT---------E 48
            :|...:.|.:|..: |.|..     .:||....:   :.....|.....|.|..|         |
 Worm   235 LLTSDIDPRDHPYIDYEAGRTIEGFYRLKDSTAIQYCIDRAIQYAPYTDLIWMETSHPTIADARE 299

  Fly    49 LAEGI---------------SIEWKQ-----------------------VSLHGISSNPRKCIYF 75
            .|||:               |..||:                       ::|.|..:|.    |.
 Worm   300 FAEGVHKQYPDKMFAYNCSPSFNWKKHLSPSQMEKFQKELGAMGFKYQFITLAGYHANS----YS 360

  Fly    76 MLD--------------------------------HKVEWNGVYGDPPQQAVNGRNGGGSEAEVD 108
            |.|                                |:.|....|.|...:||   .||.|.....
 Worm   361 MFDLARNYKEKGMLAYSGLQEGEFAAEKHGYTAVKHQREVGTGYFDAVSRAV---TGGLSSTTAL 422

  Fly   109 EGNGSDEHDEDDNFEDAV---DEQFGEVT-------ECWLMPED---IHTVDTMYS 151
            .|:     .|:..|:.||   ||:...:|       |..|.|:.   :|.::|.::
 Worm   423 SGS-----TEEAQFQTAVASQDEEILSLTAQNVAGDEKILTPDALRFLHDLNTEFN 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iclnNP_611237.2 Voldacs 33..189 CDD:281511 39/211 (18%)
icl-1NP_503306.1 PRK15063 15..431 CDD:237893 35/207 (17%)
malate_synt_A 456..964 CDD:238369 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6206
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.