DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment icln and icln-1

DIOPT Version :9

Sequence 1:NP_611237.2 Gene:icln / 36997 FlyBaseID:FBgn0029079 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001021288.1 Gene:icln-1 / 177730 WormBaseID:WBGene00002046 Length:225 Species:Caenorhabditis elegans


Alignment Length:249 Identity:54/249 - (21%)
Similarity:97/249 - (38%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VLIMRVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTEL-AEGISIEWKQVSLHGI 65
            :::..||.|..|:.....|::.......:|.||:||..:.:.|..:.. .:|.|:.:..:.||.|
 Worm     1 MILTEVSQPTEGIKLATTNVQAFFKIDSLGNGTLYITDSAVIWISSAAGTKGFSVAYPAIVLHAI 65

  Fly    66 SSN----PRKCIYFMLDHKVEWNGVYGDPPQQAVNGRNGGGSEAEVDEGNG--------SDEHDE 118
            |::    |.:.|:.|:|.:.........|..:.:.         |.||..|        .||..:
 Worm    66 STDVSVFPSEHIFVMVDQRKSVRRRRRAPVLRTIQ---------EDDEQRGLELAAAELEDEESD 121

  Fly   119 DDNFEDAVDEQFGEVTECWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGGLEDE 183
            ||..|.|::.:|        :|:|..::..:|..:...|..:|       |:.|||.|.   |:|
 Worm   122 DDEEEPALEIRF--------VPDDKDSLSQIYHQIAVGQEENP-------EEDDPMYDD---EEE 168

  Fly   184 AMEED------------------DALTLGRNGVQNL----SLDDDEERFEDADE 215
            .|||:                  |.:.:...|:.|:    ...|..:...:.||
 Worm   169 EMEEEMGDDGQGQSGQWFTADNIDHMQMSEEGLANMQRIFGRGDQHQHHHNEDE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iclnNP_611237.2 Voldacs 33..189 CDD:281511 42/186 (23%)
icln-1NP_001021288.1 Voldacs 32..160 CDD:281511 33/151 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4077
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508796at2759
OrthoFinder 1 1.000 - - FOG0006470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103509
Panther 1 1.100 - - LDO PTHR21399
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8614
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.