DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Chn1

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_038961900.1 Gene:Chn1 / 84030 RGDID:620139 Length:580 Species:Rattus norvegicus


Alignment Length:323 Identity:77/323 - (23%)
Similarity:122/323 - (37%) Gaps:59/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ANLNDFRDRDLATRMRRCNYEKYKSLVRMHLSFELELNTDEFDLPCHEIVYEDKGKLKK---WNR 71
            |.|.:..|...||.....:.::..||||.....|.|      .:|.:|.|:..|....:   |..
  Rat   283 AVLKETHDEKEATGQDGVSEKRLTSLVRRATLKENE------QIPKYEKVHNFKVHTFRGPHWCE 341

  Fly    72 LSKKHRLGHGAAATSCA-AG-----SASKSVGNSPTETLQQ-----QIDPGFLMHLQELKEFLML 125
            .......|..|....|| .|     ..||.|.|.....|:.     ..|...|:.....|..:::
  Rat   342 YCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVV 406

  Fly   126 E--------KNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSA--HDCATVFKG----F 176
            :        :.|..|||:|.:|......:::|....|.    |.|..|.  ::...:..|    :
  Rat   407 DMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDG----EKADISVNMYEDINIITGALKLY 467

  Fly   177 LSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIE 241
            ..:||.||:|...||..::.|.:..            ....|.::...|..||..|.|.|::::.
  Rat   468 FRDLPIPLITYDAYPKFIESAKIVD------------PDEQLETLHEALRSLPPAHCETLRYLMA 520

  Fly   242 MLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEV----LHYQAKKMSSIVTYMIVRGLDI 300
            .|..|..|||.|.|||:||..:|.|.|:...:|.|..    :.||     .:|..::::..||
  Rat   521 HLKRVTLHEKENLMSAENLGIVFGPTLMRSPELDPMAALNDIRYQ-----RLVVELLIKNEDI 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 51/212 (24%)
Chn1XP_038961900.1 SH2_a2chimerin_b2chimerin 163..249 CDD:198215
C1_alphaCHN 322..378 CDD:410406 13/55 (24%)
RhoGAP_chimaerin 387..580 CDD:239837 51/213 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.