DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and arhgap18

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001072336.1 Gene:arhgap18 / 779789 XenbaseID:XB-GENE-988160 Length:662 Species:Xenopus tropicalis


Alignment Length:418 Identity:98/418 - (23%)
Similarity:169/418 - (40%) Gaps:99/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEATMDTDHANLNDFRDRDLATRMRRCNYEKYKSLV-RMHLSFELELNTDEFDLPCHEI------ 58
            :|.:.....:||.||      ||:|  |.::..||: ...|:.:....|...||...::      
 Frog   229 LEISFAEQASNLKDF------TRVR--NEKEDDSLLPNFRLTQDKTGTTKIGDLAPQDMKKVSSL 285

  Fly    59 -------VYEDKGKLKKWNRLSK-KHRLGHGAAATSCAAGSASKSVGNSPTETL---QQQIDPGF 112
                   :|:..|...|..|.:| |.|               ...:...|..||   .|:..||.
 Frog   286 ALIELTALYDVLGTELKMQRAAKIKVR---------------ESGLFRVPLSTLLDQDQKRAPGT 335

  Fly   113 LMHLQELKEFLMLEK-NLTQEGLFRKAGAVSRQNELRMHIQ---HDKPLNLELAGFSAHDCATVF 173
            .:.|........:|| .|..||:.|..||.:|...|...::   ::...|.:  ....||.|::.
 Frog   336 RVPLIFQSLIGHIEKGGLDTEGILRIPGASARIKALIEELEAKFYEGTFNWD--NVKQHDAASLL 398

  Fly   174 KGFLSELPEPLLTDAHYPA--HLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELL 236
            |.|:.|||.||||..:..|  .:|..|              .::|.|.::.||::||||.||:.|
 Frog   399 KFFIRELPLPLLTVEYLKAFHSVQYLP--------------TKKHRLQALNLLVILLPEIHRDTL 449

  Fly   237 QHIIEMLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEVLHYQAK--------------KMS 287
            :.::|.|..|..|.:.|||...|:|.:..|:|.       .|..||.|              :.:
 Frog   450 KALLEFLQRVVDHREQNKMILKNVAMIMAPNLF-------SVHTYQLKTVDQGALEGAFSAARTA 507

  Fly   288 SIVTYMIVRGLDIFEVPGKLSTDIRAYFLERKRKKTMSPEQTLDESISDVSTVNTVYTFVDRAAT 352
            |::.:||.....::.:|..:...:|...:..::|  :|.|:.:.:.:..::        .||..:
 Frog   508 SVMLFMIKYQNLLWTIPKFIVAQVRRQNIVNQKK--LSKEKPMKKLLKRMA--------YDREKS 562

  Fly   353 AAATNTNNTDTELAQLYAHIQSMPESSK 380
            ...|:.|    :..|.:..:|: |:.||
 Frog   563 EKCTSEN----DAPQGFIRVQA-PQFSK 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 59/225 (26%)
arhgap18NP_001072336.1 RhoGAP_ARHGAP18 316..532 CDD:239856 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.