DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Arhgap19

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_081943.2 Gene:Arhgap19 / 71085 MGIID:1918335 Length:494 Species:Mus musculus


Alignment Length:379 Identity:116/379 - (30%)
Similarity:192/379 - (50%) Gaps:38/379 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LMHLQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSAHDCATVFKGFL 177
            :..:.:|.|:  |.|||..|||||..|...||..||..:.:...::|:...|.::|.||:.|.||
Mouse   122 IAQIYQLIEY--LHKNLRVEGLFRVPGNSVRQQLLRDALNNGTDIDLDSGEFHSNDVATLLKMFL 184

  Fly   178 SELPEPLLTDAHYPAHLQIAPLCQALN-GQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIE 241
            .||||||||..|:..||:||.|.|..: |..|...::::. :.::|||.|:||..:|.||:.:::
Mouse   185 GELPEPLLTHKHFHVHLKIADLMQFDDKGNKTNIPDKERQ-IEALQLLFLILPPANRNLLKLLLD 248

  Fly   242 MLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEVLHYQAKKMSSIVTYMIVRGLDIFEVPGK 306
            :|:..||.:..|||||.|||.:|.||::.|:.:....|.....|:::.:.:||.....:|:.|..
Mouse   249 LLYQTAKKQDKNKMSAHNLALMFAPHVLWPKNVTANDLQENIIKLNTGMAFMIKHSQKLFKAPAY 313

  Fly   307 LSTDIRAYFLERKRKKTMSPEQTLDESISDVSTVNTVYTF--------VDRAATAAATNTNNTDT 363
            :....|.|:|   ..:|...:..||.:   .|..|..:..        ||.::....|. .:|:.
Mouse   314 IRECARLYYL---GSRTQMSKDDLDLT---TSCHNMSFQLARCQRQNRVDPSSQQEETQ-QHTEE 371

  Fly   364 ELAQLYAHIQSMPESSKKRRLIKQFNKQNGQGTPLQLVVMNRLKNNEATRSAKSLGDSIKKHIFH 428
            .|.:|:.|:.:.|:|:||::|::||:||:...||.:.....|::....:||...|   ||:.:..
Mouse   372 ALRELFQHVHNWPDSAKKKQLLRQFHKQSLTQTPGREPSTPRVQKRARSRSFSGL---IKRKVLG 433

  Fly   429 KSLMSRTPKRVPPSFHLASG----SETPNMSHVKPPKMRVLFQSPTPP---TPT 475
            ..:.|......|....:|.|    :...||:         ||.|.:|.   |||
Mouse   434 SQMTSEKKNSSPAPESVAMGELKKASKENMN---------LFFSGSPAGTVTPT 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 71/200 (36%)
Arhgap19NP_081943.2 RhoGAP_ARHGAP19 113..320 CDD:239857 71/200 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..451 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842772
Domainoid 1 1.000 115 1.000 Domainoid score I6018
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13159
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5537
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008267
OrthoInspector 1 1.000 - - oto94671
orthoMCL 1 0.900 - - OOG6_108071
Panther 1 1.100 - - LDO PTHR14963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6235
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.650

Return to query results.
Submit another query.