DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Arhgap45

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001334003.1 Gene:Arhgap45 / 70719 MGIID:1917969 Length:1127 Species:Mus musculus


Alignment Length:379 Identity:85/379 - (22%)
Similarity:144/379 - (37%) Gaps:97/379 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSAHDCATVFKGFLSELPEPLLTDAHYPAH 193
            |..:|::|..|..:|..:|....::.|.| :||:..|.||.:.|.|.:|.:|||||::...|  |
Mouse   798 LHTKGIYRVNGVKTRVEKLCQAFENGKEL-VELSQASPHDISNVLKLYLRQLPEPLISFRFY--H 859

  Fly   194 LQIAPLCQALNGQTTATAERQQH------------LLNSVQLLLLLLPEEHRELLQHIIEMLHAV 246
            ..:.....:|..:..|.|..:..            ::..::.|:..||.|:|..|.::::.|..:
Mouse   860 ELVGLAKDSLKAEAEAKAASRGRQGGSESEAATLAMVGRLRELMQDLPAENRATLLYLLKHLRRI 924

  Fly   247 AKHEKSNKMSADNLATLFTPHLICPRQLPPEVLHYQAKKMSSIVTY---------MIVR-GLDIF 301
            .:.|:.|||:..||..:|.|.|:.||.....|      .:||:|.|         :||. || :|
Mouse   925 VEMEQDNKMTPGNLGIVFGPTLLRPRPTDATV------SLSSLVDYPHQARVIETLIVHYGL-VF 982

  Fly   302 EVPGKLSTDIRAYFLERKRKKTMSPEQTLDESISDVSTVNTVYTFVDRA-----ATAAATNTNNT 361
            |              |...:...|.|....:.....|....|:...:.|     .:.||:|.:::
Mouse   983 E--------------EEPEEAPGSQEGASTQCGQLESAEGIVFPLQEEAEDGSRESHAASNDSDS 1033

  Fly   362 DTE-------------------LAQLYAHIQSMPESSKKRRLIKQFNKQNGQGTPLQLVVMNRLK 407
            :.|                   |.|..|.::..|:|.....  :|...::|...| .|...|..:
Mouse  1034 ELEDASDPLSSSDASALHRLSFLEQTEAGLEEGPQSHSGSE--EQLEGEDGAPGP-WLCHFNTNQ 1095

  Fly   408 NNEATRSAKSLGDSIKKHIFHKSLMSRTPKRVPPSFHLASGSETPNMSHVKPPK 461
            :|..                     ||.|.   |:..|..|..|...|..:.|:
Mouse  1096 SNNT---------------------SRAPL---PTMRLRGGQITGGTSQERQPQ 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 55/205 (27%)
Arhgap45NP_001334003.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.