DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Chn2

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001157112.1 Gene:Chn2 / 69993 MGIID:1917243 Length:468 Species:Mus musculus


Alignment Length:312 Identity:74/312 - (23%)
Similarity:120/312 - (38%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EKYKSLVRM--------HLSFELELNTDEFDLPCHEIVYEDKGKLKKWNRLSKKHRLG---HGAA 83
            ||..||||.        |.::|   .|..|.      |:..:|  ..|.........|   .|..
Mouse   191 EKISSLVRRAALTHNDNHFNYE---KTHNFK------VHTFRG--PHWCEYCANFMWGLIAQGVR 244

  Fly    84 ATSCAAG---SASKSVGNSPTETLQQ-----QIDPGFLMHLQELKEFLMLE--------KNLTQE 132
            .:.|...   ..||.|.|.....|::     ..|...|:.....:..::::        :.|..|
Mouse   245 CSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSE 309

  Fly   133 GLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSAHDCATV------FKGFLSELPEPLLTDAHYP 191
            ||:|.:|......:::|....|.    |.|..||:....:      .|.:..:||.|::|...|.
Mouse   310 GLYRVSGFTEHIEDVKMAFDRDG----EKADISANIYPDINIITGALKLYFRDLPIPIITYDTYS 370

  Fly   192 AHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKMS 256
            ..::.|.:..|        .||    |.:|..:|:|||..|.|.|::::..|..|..:||.|.|:
Mouse   371 KFIEAAKISNA--------DER----LEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMN 423

  Fly   257 ADNLATLFTPHLICPRQLPPE-----VLH---YQAKKMSSIVTYMIVRGLDI 300
            |:||..:|.|.|:    .|||     .||   ||     .::..:::...|:
Mouse   424 AENLGIVFGPTLM----RPPEDSTLTTLHDMRYQ-----KLIVQILIENEDV 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 53/216 (25%)
Chn2NP_001157112.1 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_1 215..267 CDD:278556 11/59 (19%)
RhoGAP_chimaerin 275..468 CDD:239837 53/217 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.