DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and chn2

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_699642.6 Gene:chn2 / 570999 ZFINID:ZDB-GENE-091020-5 Length:466 Species:Danio rerio


Alignment Length:317 Identity:72/317 - (22%)
Similarity:124/317 - (39%) Gaps:98/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RRCNYEKYKSLVRMH-----------LSF------------ELELNTDEFDLPCHEIV----YED 62
            :.|||||..:. ::|           .:|            :..||..:   .|.::|    ..|
Zfish   205 KHCNYEKIHNF-KVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHK---QCSKLVPSDCQPD 265

  Fly    63 KGKLKKWNRLSKKHRLGHGAAATSCAAGSASKSVGNSPTETLQQQIDPGFLMHLQELKEFLMLEK 127
            ..::||               ..||...:..|: .|:|...:   :|    |.::|::     .:
Zfish   266 LRRIKK---------------VFSCDLTTLVKA-HNTPRPMV---LD----MCIREIE-----HR 302

  Fly   128 NLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSA------HDCATVFKGFLSELPEPLLT 186
            .|..|||:|.:|......::|:....|.    |.|..||      :..|...|.:|.:||.|::|
Zfish   303 GLKSEGLYRVSGFTEHIEDVRLSFDRDG----EKADISANIYPDINIIAGALKLYLRDLPIPVIT 363

  Fly   187 DAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEK 251
            ...|...:|.|.:        |....|    |.:|...||.||..|.|.|::::..|..|..:||
Zfish   364 YDVYSRFIQAAKI--------TDPDSR----LEAVHDGLLQLPPAHYETLRYLMTHLKRVTMYEK 416

  Fly   252 SNKMSADNLATLFTPHLICPRQLPPEV--------LHYQAKKMSSIVTYMIVRGLDI 300
            .|.|:::||..:|.|.|:    .||::        :.||     .::..:::...||
Zfish   417 DNYMNSENLGIVFGPTLM----RPPDLNTLTTLNDMRYQ-----KLIVQLLIEHEDI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 53/208 (25%)
chn2XP_699642.6 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_1 213..265 CDD:278556 6/55 (11%)
RhoGAP_chimaerin 273..466 CDD:239837 58/230 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.