DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and MYO9B

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_004136.2 Gene:MYO9B / 4650 HGNCID:7609 Length:2157 Species:Homo sapiens


Alignment Length:474 Identity:118/474 - (24%)
Similarity:188/474 - (39%) Gaps:95/474 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GH-GAAATSCAAGSASKSVGNSPTETLQQQIDPGFLMHLQELKEFLMLEKNLTQEGLFRKAGAVS 142
            || |....|..:..||..:   ..|.|.:.::    ||            .|..|||:||:||.:
Human  1696 GHFGVCVDSLTSDKASVPI---VLEKLLEHVE----MH------------GLYTEGLYRKSGAAN 1741

  Fly   143 RQNELRMHIQHDKPLNLELAGFSAHDCATVFKGFLSELPEPLLTDAHYPAHLQIAPLCQALNGQT 207
            |..|||..:|.| |..::|..|..|....|.|.:|.||||||:|.|.|...|:...|        
Human  1742 RTRELRQALQTD-PAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVEL-------- 1797

  Fly   208 TATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKMSADNLATLFTPHLI-CP 271
               .|:|:.|. ::..:|..|||.:...|:.:|..|..||..|..|:||...||.:|.|.|: ||
Human  1798 ---PEKQEQLA-AIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCP 1858

  Fly   272 RQLPPEVLHYQAKKMSSIVTYMI--------VRGLDIFEVPGKLSTDIRAYFLERK------RKK 322
            ....|........|:::.|..:|        |:..:|.::....|...|...|.|:      :..
Human  1859 DNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLG 1923

  Fly   323 TMSP-EQTLDES--ISDVSTVNTVYTFVDRAATAAATNTNNTDTELAQLYAHIQSMPESSKKRRL 384
            ..|| |..|::|  ..|:..........:.||      ..:.|.|...|...|||:.|  :|..:
Human  1924 FSSPYEGVLNKSPKTRDIQEEELEVLLEEEAA------GGDEDREKEILIERIQSIKE--EKEDI 1980

  Fly   385 IKQFNKQNGQGTPLQLVVMNRLKNNEATRSAKSLGDSIKKHIFHKSLMSRTPKRVPPSFHL-ASG 448
            ..:..:.:.:|:..:.:      ::|.:.|.:||         .:....|.....||:..| ..|
Human  1981 TYRLPELDPRGSDEENL------DSETSASTESL---------LEERAGRGASEGPPAPALPCPG 2030

  Fly   449 SETPNMSHVKPPKMRVLFQSPT---PPTPTSSTITSVSLSTNTRHQLQKSISSASLKIESSSSDS 510
            :.||:             ..||   ||....|:..:|.:.|..|..:   :.:|::|:.......
Human  2031 APTPS-------------PLPTVAAPPRRRPSSFVTVRVKTPRRTPI---MPTANIKLPPGLPSH 2079

  Fly   511 SSSCATSG-SISAPVSRQQ 528
            ....|... ..:|||.|::
Human  2080 LPRWAPGAREAAAPVRRRE 2098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 64/214 (30%)
MYO9BNP_004136.2 Myosin_IXb_RA 7..112 CDD:176374
MYSc 141..950 CDD:214580
MYSc_Myo9 160..941 CDD:276836
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..734
Actin-binding. /evidence=ECO:0000305 844..855
Neck or regulatory domain. /evidence=ECO:0000305 940..1044
IQ 978..999 CDD:197470
IQ 1000..1022 CDD:197470
Tail. /evidence=ECO:0000305 1045..2157 118/474 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1046..1298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1320..1410
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1455..1484
C1 1633..1681 CDD:237996
RhoGAP_myosin_IXB 1698..1883 CDD:239872 67/216 (31%)
Interaction with RHOA. /evidence=ECO:0000269|PubMed:26529257 1739..1744 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1980..2157 27/150 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.