DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and conu

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster


Alignment Length:212 Identity:52/212 - (24%)
Similarity:98/212 - (46%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MLEKNLTQEGLFRKAGAVSR----QNELRMHIQHDKPLNLE--LAGFSAHDCATVFKGFLSELPE 182
            :|.:...:|||.|..|...:    .|||.... :..|.||:  ....:.|:.:::.|.:|.|||:
  Fly   390 LLRRGSREEGLLRIGGHKQKTELLYNELESTF-YQNPDNLDNLFRTATVHELSSLLKRWLRELPQ 453

  Fly   183 PLLTD----AHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEML 243
            ||||:    ..|..|             |..:.::    :|::.:|..|||.|:|..|:.::...
  Fly   454 PLLTNELIQLFYQCH-------------TLPSIDQ----MNALSILCHLLPPENRNTLRSLLSFF 501

  Fly   244 HAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEVLHYQAKKM------SSIVTYMIVRGLDIFE 302
            :.:...:..|||:..|:||:..|.:..||.:.|...:..|:::      ..:...:|:||..:|:
  Fly   502 NIIINLKDINKMNVHNVATIMAPSMFPPRYIHPSDNNSIAEQVRMAAQCCRLTNILILRGEKLFQ 566

  Fly   303 VPGKLSTDIRAYFLERK 319
            ||..|..:.:...:.:|
  Fly   567 VPNNLIVESQKTMMGKK 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 51/204 (25%)
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.