DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and RhoGAP5A

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:116/273 - (42%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FDLPCHEIVYEDKGKLKKWNRLSKKHRLGHGAAATSCAA------GSASKSV------------G 97
            ::.|.|..|:..||  ..|.........|..|....|.|      ...|:.|            |
  Fly   238 YEKPHHFKVHTFKG--LNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIRG 300

  Fly    98 NSPTE-TLQQQIDP----GFLMH--LQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHI--QH 153
            ...|: |...|::|    .|::.  ::|::     .:.:.|||::|.:|.......|::.:  :.
  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVE-----ARGMLQEGIYRVSGFADEIEALKLALDREG 360

  Fly   154 DKPLNLELAGFSAHDCATVFKGFLSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLL 218
            :|....|.|..:.:..|...|.:|..||.||:|...||:.:..        |:|...||::|.:.
  Fly   361 EKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAA--------GRTGKQAEQRQLMA 417

  Fly   219 NSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKMSADNLATLFTPHLICPRQ----LPPEVL 279
            .:|:    .||..|...||:::|.|..||.|...|||:..||||:|.|.||...|    |..|:.
  Fly   418 EAVR----RLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIF 478

  Fly   280 HYQAKKMSSIVTY 292
                 .:||::|:
  Fly   479 -----MLSSLITH 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 56/198 (28%)
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 11/53 (21%)
RhoGAP_chimaerin 302..491 CDD:239837 58/207 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.