DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Arhgap18

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001164046.1 Gene:Arhgap18 / 293947 RGDID:1305053 Length:665 Species:Rattus norvegicus


Alignment Length:459 Identity:105/459 - (22%)
Similarity:184/459 - (40%) Gaps:91/459 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEATMDTDHANLNDFR---DRDLATRMRRCNYEKYKSLVRMHLSFELELNTDEFDLPCHEIVYED 62
            |:.|...| |:|..||   |:...||:.....:..|.:..:.|   :||..          :|:.
  Rat   253 MQKTRGND-ASLPSFRLPKDKTGTTRIGDLAPQDMKKVCYLSL---IELTA----------LYDV 303

  Fly    63 KG-KLKKWNRLSKKHRLGHGAAATSCAAGSASKSVGNSPTETLQQQID---PGFLMHLQELKEFL 123
            .| :||:...:..|.|               ...:...|...|.:|..   ||..:.|...|...
  Rat   304 LGVELKQQKAVKIKTR---------------DSGLFGIPLTILLEQDQRKVPGTRIPLIFQKLIS 353

  Fly   124 MLEK-NLTQEGLFRKAGAVSRQNELRMHIQ---HDKPLNLELAGFSAHDCATVFKGFLSELPEPL 184
            .:|: :|..|||.|..||..|...|...::   ::...|.|  ....||.|::.|.||.|||:||
  Rat   354 CIEEGSLETEGLLRIPGAAMRVKNLCQELEAKFYEGTFNWE--SVKQHDAASLLKLFLRELPQPL 416

  Fly   185 LTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKH 249
            |:..:..|.       ||:  |...|.:.|...||   ||::|||:.:|:.|:.::|.|..|..:
  Rat   417 LSTEYLKAF-------QAV--QNLPTKKEQLQALN---LLVILLPDANRDTLKALLEFLQRVIDN 469

  Fly   250 EKSNKMSADNLATLFTPHLICPRQLPPEVLHYQ--------AKKMSSIVTYMIVRGLDIFEVPGK 306
            ::.|||:|.|:|.:..|:|.....|..:...::        |..|..::.|..:    ::.:|..
  Rat   470 KEKNKMTAVNVAMVMAPNLFMCHALGLKSSEHREFEMAAGTANTMHLLIRYQKL----LWTIPKF 530

  Fly   307 LSTDIRAYFLERKRKKTMSPEQTLDESISDVSTVNTVYTFVDRAATAAATNTNNTDT-------- 363
            :...:|.:....::|:..:.::.|.:...|    ...:...||||       |..|.        
  Rat   531 IVNQVRKHNTAHQKKERRAMKKLLKKMAYD----REKHEKQDRAA-------NGADVPQGVIRVQ 584

  Fly   364 --ELAQLYAHIQSMPESSKKRRLIKQFNKQNGQGTPLQL--VVMNRLKNNEATRSAKSLGDSIKK 424
              .|:::...||...|......|.:..::::|....|:.  |.:..:..|...|....  |:..|
  Rat   585 APHLSKVSMAIQLTEELKASDVLARFLSQESGVAQTLKKGEVFLYEIGGNIGERCLDD--DTYMK 647

  Fly   425 HIFH 428
            .::|
  Rat   648 DLYH 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 60/220 (27%)
Arhgap18NP_001164046.1 RhoGAP_ARHGAP18 323..536 CDD:239856 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.