DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Myo9b

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_038950134.1 Gene:Myo9b / 25486 RGDID:3146 Length:2156 Species:Rattus norvegicus


Alignment Length:476 Identity:112/476 - (23%)
Similarity:185/476 - (38%) Gaps:99/476 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GH-GAAATSCAAGSASKSVGNSPTETLQQQIDPGFLMHLQELKEFLMLEKNLTQEGLFRKAGAVS 142
            || |....|..:..||..:   ..|.|.:.::    ||            .|..|||:||:||.:
  Rat  1694 GHFGVCVDSLTSDKASVPI---VLEKLLEHVE----MH------------GLYTEGLYRKSGAAN 1739

  Fly   143 RQNELRMHIQHDKPLNLELAGFSAHDCATVFKGFLSELPEPLLTDAHYPAHLQIAPLCQALNGQT 207
            |..|||..:|.| |..::|..|..|....|.|.:|.||||||:|.|.|...|:...|        
  Rat  1740 RTRELRQALQTD-PATVKLEDFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVEL-------- 1795

  Fly   208 TATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKMSADNLATLFTPHLI-CP 271
               .|:|:.|. ::..:|..|||.:...|:.:|..|..||..|..|:||...||.:|.|.|: ||
  Rat  1796 ---PEKQEQLA-AIYAVLDHLPEANHTSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCP 1856

  Fly   272 RQLPPEVLHYQAKKMSSIVTYMI--------VRGLDIFEVPGKLSTDIRAYFLERKRK------- 321
            ....|........|:::.|..:|        |:..:|..:....|...|...|.|:..       
  Rat  1857 DNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEINHLEAAESIAFRRLSLLRQNAPWPLKLG 1921

  Fly   322 --------KTMSPEQTLDESISDVSTVNTVYTFVDRAATAAATNTNNTDTELAQLYAHIQSMPES 378
                    :|.||...:.:.:.::..:      .:.||      ..:.|.|...|...|||:.| 
  Rat  1922 FSSPYEGVRTKSPRTPVVQDLEELGAL------PEEAA------GGDEDREKEILMERIQSIKE- 1973

  Fly   379 SKKRRLIKQFNKQNGQGTPLQLVVMNRLKNNEATRSAKSLGDSIKKHIFHKSLMSRTPKRVPPSF 443
             :|..:..:..:.:.:|:..:.:      ::|.:.|.:||            |..|..:..    
  Rat  1974 -EKEDITYRLPELDPRGSDEENL------DSETSASTESL------------LEERAVRGA---- 2015

  Fly   444 HLASGSETPNMSHVKPPKMRVLFQSPTPPTPTSSTITSVSLSTNTRHQLQKSISSASLKIESSSS 508
              |.|...|.:.....|....|..:..||....::..:|.:.|..|..:   :..|::|:.....
  Rat  2016 --AEGPPAPALPCPISPTPNPLPAATAPPRGRPTSFVTVRVKTPRRTPI---MPMANIKLPPGLP 2075

  Fly   509 DSSSSCATS-GSISAPVSRQQ 528
            ...:|.|.: ...:.||.|::
  Rat  2076 LHLTSWAPALQEAAVPVKRRE 2096

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 64/214 (30%)
Myo9bXP_038950134.1 Ubiquitin_like_fold 16..112 CDD:421700
MYSc_Myo9 160..977 CDD:276836
IQ 1014..1033 CDD:197470
IQ 1036..1058 CDD:197470
PTZ00449 <1145..1493 CDD:185628
C1_Myosin-IXb 1626..1683 CDD:410434
RhoGAP 1696..1881 CDD:413382 67/216 (31%)
MCP_Sipho 1941..>2064 CDD:411416 27/163 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.