DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and Myo9b

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_006509629.1 Gene:Myo9b / 17925 MGIID:106624 Length:2164 Species:Mus musculus


Alignment Length:435 Identity:102/435 - (23%)
Similarity:158/435 - (36%) Gaps:129/435 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GH-GAAATSCAAGSASKSVGNSPTETLQQQIDPGFLMHLQELKEFLMLEKNLTQEGLFRKAGAVS 142
            || |....|..:..||..:   ..|.|.:.::    ||            .|..|||:||:||.:
Mouse  1704 GHFGVCVDSLTSDKASVPI---VLEKLLEHVE----MH------------GLYTEGLYRKSGAAN 1749

  Fly   143 RQNELRMHIQHDKPLNLELAGFSAHDCATVFKGFLSELPEPLLTDAHYPAHLQIAPLCQALNGQT 207
            |..|||..:|.| |..::|..|..|....|.|.:|.||||||:|.|.|...|:...|        
Mouse  1750 RTRELRQALQTD-PAAVKLEDFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVEL-------- 1805

  Fly   208 TATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKMSADNLATLFTPHLI-CP 271
               .|:|:. |:::..:|..|||.:...|:.:|..|..||..|..|:||...||.:|.|.|: ||
Mouse  1806 ---PEKQEQ-LSAIYAVLDHLPEANHTSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCP 1866

  Fly   272 RQLPPEVLHYQAKKMSSIVTYMIVRGLDIFEVPGKLSTDIRAYFLERKRKKTMSPEQTLDESISD 336
            ....|      ...|..::               |::|.:.....|:.||..|..|:        
Mouse  1867 DNSDP------LTSMKDVL---------------KITTCVEMLIKEQMRKYKMKMEE-------- 1902

  Fly   337 VSTVNTVYTFVDRAATAAATNTNNTDTELAQLYAHIQSMPESSKKRRLIKQFNKQN-------GQ 394
               :|                             |::: .||...|||  ...:||       |.
Mouse  1903 ---IN-----------------------------HLEA-AESIAFRRL--SLLRQNAPWPLKLGF 1932

  Fly   395 GTPLQLV--------VMNRLKNNEATRSAKSLGDSIKKHIFHKSLMSRTPKRVPPSFHLAS---- 447
            .:|.:.|        |:..|:.......|....:..:|.|..:.:.|...::...::.|..    
Mouse  1933 SSPYEGVRIKSPRTPVVQDLELGALPEEAAGGDEDREKEILMERIQSIKEEKEDITYRLPELDPR 1997

  Fly   448 GSETPNMSHVKPPKMRVLFQ------------SPTPPTPTSSTIT 480
            ||:..|:..........|.:            :|..|.|.|.|::
Mouse  1998 GSDEENLDSETSASTESLLEERGVRGAVEGPPAPALPCPISPTLS 2042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 61/206 (30%)
Myo9bXP_006509629.1 RA_Myosin-IXb 16..112 CDD:340737
MYSc_Myo9 160..977 CDD:276836
IQ 1014..1035 CDD:197470
IQ 1036..1058 CDD:197470
DUF4045 1207..>1495 CDD:372533
C1 1641..1689 CDD:237996
RhoGAP_myosin_IXB 1706..1891 CDD:239872 67/237 (28%)
PHA02682 <2029..>2123 CDD:177464 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.