DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and chin-1

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:160 Identity:43/160 - (26%)
Similarity:77/160 - (48%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGF-SAHDCATVFKGFLSELPEPLLTDAHY 190
            :.|..||::|.:|:.....:|:.  |.|....::||.. ..|....:.|.:...||:.|:.   :
 Worm   261 RGLDVEGIYRVSGSYDHMEKLKQ--QFDSNQYVDLATVCDIHTVCGLLKLYFRLLPQQLIP---F 320

  Fly   191 PAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQHIIEMLHAVAKHEKSNKM 255
            ..|.|:....|..|.::|...|||      ::.:::.|.:.:...|..::..|..||.|...|||
 Worm   321 SVHKQLLVAYQETNQRSTHERERQ------IRKVMMELSDANIITLGAVLAHLKKVADHSAKNKM 379

  Fly   256 SADNLATLFTPHLICPRQLPP----EVLHY 281
            :.:||||:|:|.|.|...:|.    ::||:
 Worm   380 TVENLATIFSPTLFCSGSIPAMPNHQLLHF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 43/160 (27%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_1 172..224 CDD:278556
RhoGAP 248..413 CDD:238090 43/160 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.