DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and CHN1

DIOPT Version :10

Sequence 1:NP_611236.2 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001358443.1 Gene:CHN1 / 1123 HGNCID:1943 Length:476 Species:Homo sapiens


Alignment Length:201 Identity:50/201 - (24%)
Similarity:86/201 - (42%) Gaps:44/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MHLQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSA--HDCATVFKG- 175
            |.::|::     .:.|..|||:|.:|......:::|....|.    |.|..|.  ::...:..| 
Human   304 MCIREIE-----SRGLNSEGLYRVSGFSDLIEDVKMAFDRDG----EKADISVNMYEDINIITGA 359

  Fly   176 ---FLSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQ 237
               :..:||.||:|...||..::.|.:..            ....|.::...|.|||..|.|.|:
Human   360 LKLYFRDLPIPLITYDAYPKFIESAKIMD------------PDEQLETLHEALKLLPPAHCETLR 412

  Fly   238 HIIEMLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEV--------LHYQAKKMSSIVTYMI 294
            :::..|..|..|||.|.|:|:||..:|.|.|:    ..||:        :.||     .:|..::
Human   413 YLMAHLKRVTLHEKENLMNAENLGIVFGPTLM----RSPELDAMAALNDIRYQ-----RLVVELL 468

  Fly   295 VRGLDI 300
            ::..||
Human   469 IKNEDI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_611236.2 RhoGAP 107..313 CDD:470621 50/201 (25%)
CHN1NP_001358443.1 SH2 67..145 CDD:472789
C1_alphaCHN 218..274 CDD:410406
RhoGAP_chimaerin 283..476 CDD:239837 50/201 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.