Sequence 1: | NP_001261060.1 | Gene: | RhoGAP54D / 36996 | FlyBaseID: | FBgn0034249 | Length: | 1004 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358443.1 | Gene: | CHN1 / 1123 | HGNCID: | 1943 | Length: | 476 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 50/201 - (24%) |
---|---|---|---|
Similarity: | 86/201 - (42%) | Gaps: | 44/201 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 MHLQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSA--HDCATVFKG- 175
Fly 176 ---FLSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQ 237
Fly 238 HIIEMLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEV--------LHYQAKKMSSIVTYMI 294
Fly 295 VRGLDI 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP54D | NP_001261060.1 | RhoGAP | 107..313 | CDD:295372 | 50/201 (25%) |
CHN1 | NP_001358443.1 | SH2 | 67..145 | CDD:387587 | |
C1_1 | 223..272 | CDD:365894 | |||
RhoGAP_chimaerin | 283..476 | CDD:239837 | 50/201 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1453 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |