DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and CHN1

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001358443.1 Gene:CHN1 / 1123 HGNCID:1943 Length:476 Species:Homo sapiens


Alignment Length:201 Identity:50/201 - (24%)
Similarity:86/201 - (42%) Gaps:44/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MHLQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHIQHDKPLNLELAGFSA--HDCATVFKG- 175
            |.::|::     .:.|..|||:|.:|......:::|....|.    |.|..|.  ::...:..| 
Human   304 MCIREIE-----SRGLNSEGLYRVSGFSDLIEDVKMAFDRDG----EKADISVNMYEDINIITGA 359

  Fly   176 ---FLSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLPEEHRELLQ 237
               :..:||.||:|...||..::.|.:..            ....|.::...|.|||..|.|.|:
Human   360 LKLYFRDLPIPLITYDAYPKFIESAKIMD------------PDEQLETLHEALKLLPPAHCETLR 412

  Fly   238 HIIEMLHAVAKHEKSNKMSADNLATLFTPHLICPRQLPPEV--------LHYQAKKMSSIVTYMI 294
            :::..|..|..|||.|.|:|:||..:|.|.|:    ..||:        :.||     .:|..::
Human   413 YLMAHLKRVTLHEKENLMNAENLGIVFGPTLM----RSPELDAMAALNDIRYQ-----RLVVELL 468

  Fly   295 VRGLDI 300
            ::..||
Human   469 IKNEDI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 50/201 (25%)
CHN1NP_001358443.1 SH2 67..145 CDD:387587
C1_1 223..272 CDD:365894
RhoGAP_chimaerin 283..476 CDD:239837 50/201 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.