DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP54D and arhgap28

DIOPT Version :9

Sequence 1:NP_001261060.1 Gene:RhoGAP54D / 36996 FlyBaseID:FBgn0034249 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_002938100.2 Gene:arhgap28 / 100488165 XenbaseID:XB-GENE-1013085 Length:661 Species:Xenopus tropicalis


Alignment Length:479 Identity:103/479 - (21%)
Similarity:177/479 - (36%) Gaps:137/479 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CNYEKYKSLVRMHLSFEL-------------------ELNTDEFDLP-------------CHEIV 59
            |..||....|...||||.                   .:..|:..||             ..::.
 Frog   213 CTLEKPSPSVAEELSFEASFSETVAVDGKDKESEKNQRIKKDDSALPKFIVWKSRFGLTEVGDLS 277

  Fly    60 YEDKGKLK------------------KWNRL----SKKHRLGHGAAATSCAAGSASKSVGNSPTE 102
            .||..|::                  |.||:    .|::.| .|...|:.......|..|.....
 Frog   278 LEDMKKIRYLSLIELTAFYDALGIELKRNRIVRIKGKENGL-FGVPLTTLLESDQKKFPGTKVPL 341

  Fly   103 TLQQQIDPGFLMHLQELKEFLMLEKNLTQEGLFRKAGAVSRQNELRMHIQ---HDKPLNLELAGF 164
            ..|:.        ||.|:     |..|..||:.|..|:.:|...||..::   ||.  :.:....
 Frog   342 IFQKL--------LQRLE-----ETGLETEGILRVPGSAARVKNLREELEAKFHDN--SFDWNKV 391

  Fly   165 SAHDCATVFKGFLSELPEPLLTDAHYPAHLQIAPLCQALNGQTTATAERQQHLLNSVQLLLLLLP 229
            ..:|.|.:.|.|:.|||.||.|..:.||.:.:......:..|           |.::.||::|||
 Frog   392 RNNDAAGLLKMFIRELPSPLFTMEYLPAFITLVEKISKIKLQ-----------LQALHLLIMLLP 445

  Fly   230 EEHRELLQHIIEMLHAVAKHEKSNKMSADNLATLFTPHL-ICPRQLPPEVLHYQAKKMSSIVTYM 293
            :.:|:..:.::..|..|..:|:.||||..|::.:..|:| ||.|:...:. ..:|...::.:..:
 Frog   446 DANRDTAKALLNFLKKVVSNEEKNKMSLWNVSMILAPNLFICKRKSTNKE-EMKAAASTAHIVRL 509

  Fly   294 IVRGLDI-FEVPGKLSTDIR----AYFLERK-------------RKKTMSPEQTLDESISDV-ST 339
            ::|..|| :.||..|.:.:|    |..:..|             |:|||..|:.......|| ..
 Frog   510 LIRYQDILWTVPSFLISQVRKMNEAALINNKRQLIFDKSVRRLLRRKTMERERPERREHCDVPEG 574

  Fly   340 VNTVYTFVDRAATAAATNTNNTDTELAQLYAHIQ---SMPESSKKRRLIKQFNKQNGQGTPLQLV 401
            |..||                     |.|::.:.   .:...:|.:.::.:|:.:|..||...:.
 Frog   575 VIRVY---------------------APLHSKVSMAIQLNSRTKAKDILARFHCENSHGTSDNVR 618

  Fly   402 VMNRLKNNEATRSAKSLGDSIKKH 425
            :.|        :|...:|.:|.:|
 Frog   619 IHN--------QSLYEIGGNIGEH 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP54DNP_001261060.1 RhoGAP 107..313 CDD:295372 55/214 (26%)
arhgap28XP_002938100.2 RhoGAP_ARHGAP18 318..529 CDD:239856 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.