DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6484 and AMF1

DIOPT Version :9

Sequence 1:NP_611234.1 Gene:CG6484 / 36994 FlyBaseID:FBgn0034247 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_015023.1 Gene:AMF1 / 854560 SGDID:S000005905 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:50/243 - (20%)
Similarity:79/243 - (32%) Gaps:85/243 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 WTGINAVLFYSASIFEDTGSDISGSDATLIIGVTQVTSTLVAVAIID---KAGRRILLLISGVLM 323
            |:.:.....||..||.|......|.....::.        .|:||:.   |.|||..::.|  |.
Yeast   123 WSLLAGFSVYSNQIFFDCCRAFQGMGPAFLLP--------NAIAILGRTYKPGRRKNMVFS--LF 177

  Fly   324 AVSTA---LMGVYFQLKENDPASMDNFGWLP----ISSICIFII----FFSIGFGPVPWLVMAEL 377
            ..|..   .:|..|.      :.:....|.|    |..|..|::    :|.|...|:|       
Yeast   178 GASAPGGFFLGAVFS------SMLGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMP------- 229

  Fly   378 FSEDVKS--------VAGSIAG---------------TSNWLSAFVVTLL--------------- 404
             |.|..|        .|||:.|               ...|.:.:...||               
Yeast   230 -SRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIES 293

  Fly   405 ---FPILKSSIGPGPTFWIFTAIAV------IAFFYSLFFVPETKGKT 443
               ||:|..:.....|.::.:.||.      |..||:..|:.:::|:|
Yeast   294 RAAFPLLPFAALSSDTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6484NP_611234.1 Sugar_tr 14..451 CDD:278511 50/243 (21%)
MFS 14..436 CDD:119392 47/234 (20%)
AMF1NP_015023.1 MFS_Amf1_MDR_like 48..493 CDD:341029 50/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.