Sequence 1: | NP_611234.1 | Gene: | CG6484 / 36994 | FlyBaseID: | FBgn0034247 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015023.1 | Gene: | AMF1 / 854560 | SGDID: | S000005905 | Length: | 515 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 243 | Identity: | 50/243 - (20%) |
---|---|---|---|
Similarity: | 79/243 - (32%) | Gaps: | 85/243 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 WTGINAVLFYSASIFEDTGSDISGSDATLIIGVTQVTSTLVAVAIID---KAGRRILLLISGVLM 323
Fly 324 AVSTA---LMGVYFQLKENDPASMDNFGWLP----ISSICIFII----FFSIGFGPVPWLVMAEL 377
Fly 378 FSEDVKS--------VAGSIAG---------------TSNWLSAFVVTLL--------------- 404
Fly 405 ---FPILKSSIGPGPTFWIFTAIAV------IAFFYSLFFVPETKGKT 443 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6484 | NP_611234.1 | Sugar_tr | 14..451 | CDD:278511 | 50/243 (21%) |
MFS | 14..436 | CDD:119392 | 47/234 (20%) | ||
AMF1 | NP_015023.1 | MFS_Amf1_MDR_like | 48..493 | CDD:341029 | 50/243 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0254 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |