DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6484 and STP4

DIOPT Version :10

Sequence 1:NP_611234.1 Gene:CG6484 / 36994 FlyBaseID:FBgn0034247 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_188627.1 Gene:STP4 / 821531 AraportID:AT3G19930 Length:514 Species:Arabidopsis thaliana


Alignment Length:83 Identity:20/83 - (24%)
Similarity:31/83 - (37%) Gaps:27/83 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SVEQWW---SLYCHLIKPTSL---------------------KPYRRLHLF--KSGIKPMWEDPS 110
            |.|.:|   |.:.:.||..:|                     |..||:|||  .:|:...|:...
plant   245 SPENYWAWKSSFQNAIKDLNLSASEMLDLMIKWLGTESAEHAKSMRRVHLFNPSAGLDMAWQRLE 309

  Fly   111 NSKGGKWVI-RLKKSKID 127
            ...|...|| |..:.::|
plant   310 KKYGSPEVIQRTLQKRLD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6484NP_611234.1 MFS_GLUT6_8_Class3_like 10..446 CDD:340916 20/83 (24%)
STP4NP_188627.1 MFS_STP 29..474 CDD:340919 20/83 (24%)

Return to query results.
Submit another query.