DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6484 and K09C4.2

DIOPT Version :9

Sequence 1:NP_611234.1 Gene:CG6484 / 36994 FlyBaseID:FBgn0034247 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:103 Identity:27/103 - (26%)
Similarity:45/103 - (43%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 GFGPVPWLVMAELFSEDVKSVAGSIAGTSNWLSAFVVTLLFPILKSSIGPGPTFWI-FTAIAVIA 428
            |...:..|.:.|||....::|.|......:......|..||||:.|..  .|.|:: |..:..:.
 Worm    13 GANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIINSIF--SPIFFVPFVIVQTVF 75

  Fly   429 FFYSLFFVPETKGKT---IIEIQDLLSGGKGVKSDDKS 463
            ..|...::|||:|:.   |||..|.....:.|..|:::
 Worm    76 GIYLYRYMPETRGRAVYDIIESMDKDVASRAVSIDEEN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6484NP_611234.1 Sugar_tr 14..451 CDD:278511 25/89 (28%)
MFS 14..436 CDD:119392 17/71 (24%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.