DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6484 and LOC101882789

DIOPT Version :9

Sequence 1:NP_611234.1 Gene:CG6484 / 36994 FlyBaseID:FBgn0034247 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:136 Identity:37/136 - (27%)
Similarity:63/136 - (46%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LGMCGGAFCVTAPMYCTEITATALRGTIGSFFQLLIVSG-----VLYG-----------YLVGAF 161
            :.:|.|...:|.|:|..|.:...|||.:.:...|.|.:|     |:.|           |::|  
Zfish    12 MSICAGIASMTVPVYIAETSPPHLRGRLVTINTLFITAGQFTASVIDGAFSYMKHEGWRYMLG-- 74

  Fly   162 LPLLTINILCAILPVIFAIIHF-FMPESPVYLAMKGRNDDAAKALQWLRGKDADIDDE---LKEI 222
                     .:::|.:...:.| |:||||.:|..||....|.:.|..:|| :.:||:|   :|..
Zfish    75 ---------LSVIPALLQFLGFLFLPESPRWLIQKGLTQKARRVLSQIRG-NQNIDEEYDTIKSS 129

  Fly   223 LEESQK 228
            :||.:|
Zfish   130 IEEEEK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6484NP_611234.1 Sugar_tr 14..451 CDD:278511 37/136 (27%)
MFS 14..436 CDD:119392 37/136 (27%)
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.