DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-2 and MRPL3

DIOPT Version :9

Sequence 1:NP_523778.2 Gene:Dcr-2 / 36993 FlyBaseID:FBgn0034246 Length:1722 Species:Drosophila melanogaster
Sequence 2:NP_013737.1 Gene:MRPL3 / 855039 SGDID:S000004626 Length:390 Species:Saccharomyces cerevisiae


Alignment Length:427 Identity:89/427 - (20%)
Similarity:141/427 - (33%) Gaps:160/427 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1330 RFV-EGCRANGQSFYAGADFSSEVNFCVGLVTIPNKVIADTLEALLGVIVKNYGLQHAFKMLE-- 1391
            ||: |...|..:.:|.|  ..|.||      .||..|.:           |:..|:...|.|:  
Yeast    63 RFLPESELAKYKEYYQG--LKSTVN------EIPESVAS-----------KSPSLRTLHKRLQLP 108

  Fly  1392 ----YFKICRADIDKPLTQLLNLELGGKKMRANVNTTEIDGFLINH--YYLEKNLGYTFKDRRYL 1450
                |..:.|. :..|..:|.:......|..|.|||...:.:|.||  ..:.||| .::...:.:
Yeast   109 NELTYSTLSRC-LTCPSAKLPDKINNPTKGAAFVNTVPTNKYLDNHGLNIMGKNL-LSYHVTKSI 171

  Fly  1451 LQALTHPSYPT---NRITGSYQELEFIGDAILDFLISAYIFENNT--------KMNPGALTDLRS 1504
            :|  .:|..||   |....:|     |.:|:|..:...:..|..|        ||.|...|    
Yeast   172 IQ--KYPRLPTVVLNAAVNAY-----ISEAVLAHIAKYWGIEVETTSVLSRYLKMEPFEFT---- 225

  Fly  1505 ALVNNTTLACICVRHRLHFFILAENAK--LSEIISKFVNFQESQGHRVTNYVRILL-------EE 1560
                         ..||.||..:.|:|  :..|..|  ||.|:....::  ||.::       |:
Yeast   226 -------------LGRLKFFNNSLNSKDGIELITGK--NFSETSALAMS--VRSIIAAIWAVTEQ 273

  Fly  1561 ADVQPTPLDLDDELDMTELPHANKCISQEAEKGVPPKGEFNMSTNVDVPKALGDVLEALIAAVYL 1625
            .|.|.....:||.:                           ||..:|:.|               
Yeast   274 KDSQAVYRFIDDHI---------------------------MSRKLDITK--------------- 296

  Fly  1626 DCRDLQRTWEVIFNLFEPELQEFTRKVPINHIRQLVEHKHAK-----------PVFSSPIVEGET 1679
                       :|...:|     ||::.:...|:.:|...:|           |||...:..||.
Yeast   297 -----------MFQFEQP-----TRELAMLCRREGLEKPVSKLVAESGRLSKSPVFIVHVFSGEE 345

  Fly  1680 VMVSCQFTCMEKTIKVYGFGSNKDQAKLSAAKHALQQ 1716
            .:..             |:||:..:||..||..||.:
Yeast   346 TLGE-------------GYGSSLKEAKARAATDALMK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-2NP_523778.2 MPH1 6..542 CDD:224036
DEXDc 22..173 CDD:238005
Dicer_PBD 241..343 CDD:277191
HELICc <438..495 CDD:197757
Dicer_dimer 572..665 CDD:281376
PAZ 843..1004 CDD:198017
RIBOc 1194..1391 CDD:238333 15/61 (25%)
Rnc 1433..1719 CDD:223644 62/317 (20%)
RIBOc 1448..1649 CDD:238333 39/220 (18%)
dsrm 1653..1717 CDD:278464 17/75 (23%)
MRPL3NP_013737.1 Rnc 114..376 CDD:223644 72/357 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.