DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-2 and RTL2

DIOPT Version :9

Sequence 1:NP_523778.2 Gene:Dcr-2 / 36993 FlyBaseID:FBgn0034246 Length:1722 Species:Drosophila melanogaster
Sequence 2:NP_566661.1 Gene:RTL2 / 821587 AraportID:AT3G20420 Length:391 Species:Arabidopsis thaliana


Alignment Length:293 Identity:84/293 - (28%)
Similarity:128/293 - (43%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1436 LEKNLGYTFKDRRYLLQALTHPS---YPTNRITGSYQELEFIGDAILDFLISAYIFENNTKMNPG 1497
            :||.|.|.|.::..|.:|:||.|   :|      ||:.||||||:.:...||.|::.....:.|.
plant    63 VEKILNYKFSNKSLLKEAITHTSCTDFP------SYERLEFIGDSAIGLAISNYLYLTYPSLEPH 121

  Fly  1498 ALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFVNFQESQGHRVTNYVRILLEEAD 1562
            .|:.||:|.|:...||.:.:.|.|:.|:......|.|   |...|.|:.|.              
plant   122 DLSLLRAANVSTEKLARVSLNHGLYSFLRRNAPSLDE---KVKEFSEAVGK-------------- 169

  Fly  1563 VQPTPLDLDDELDMTELPHANKCISQEAEKGVPPKGEFNMSTNVDVPKALGDVLEALIAAVYLDC 1627
                    :|:|.:                        :....|..||.|.|:.|:|..|||:|.
plant   170 --------EDDLSV------------------------SYGGLVKAPKVLADLFESLAGAVYVDV 202

  Fly  1628 R-DLQRTWEVIFNLFEP-----ELQEFTRKVPINHIRQLVEHKHAKPVFSSPIVEGETVMVSCQF 1686
            . ||||.|.:...|.||     :||:  :..|::.:.:|. |||.|.:......:|.   ||...
plant   203 NFDLQRLWVIFRGLLEPIVTLDDLQK--QPQPVSMLFKLC-HKHKKRIDIKNWKDGN---VSIAV 261

  Fly  1687 TCMEKTIKVYGFGSNKDQAKLSAAKHALQQLSK 1719
            ..::..:...|...|||.|:|.|||.||::||:
plant   262 IYLDDELLASGRAENKDIARLIAAKEALRKLSE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-2NP_523778.2 MPH1 6..542 CDD:224036
DEXDc 22..173 CDD:238005
Dicer_PBD 241..343 CDD:277191
HELICc <438..495 CDD:197757
Dicer_dimer 572..665 CDD:281376
PAZ 843..1004 CDD:198017
RIBOc 1194..1391 CDD:238333
Rnc 1433..1719 CDD:223644 83/291 (29%)
RIBOc 1448..1649 CDD:238333 57/209 (27%)
dsrm 1653..1717 CDD:278464 20/63 (32%)
RTL2NP_566661.1 Rnc 54..294 CDD:223644 83/291 (29%)
RIBOc 75..226 CDD:238333 55/205 (27%)
dsrm 232..292 CDD:278464 20/63 (32%)
DSRM 313..385 CDD:238007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.