DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-2 and MRPL44

DIOPT Version :10

Sequence 1:NP_523778.2 Gene:Dcr-2 / 36993 FlyBaseID:FBgn0034246 Length:1722 Species:Drosophila melanogaster
Sequence 2:NP_075066.1 Gene:MRPL44 / 65080 HGNCID:16650 Length:332 Species:Homo sapiens


Alignment Length:264 Identity:53/264 - (20%)
Similarity:88/264 - (33%) Gaps:83/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1519 HRLHFFILAENAKLSEIISKFVNFQESQGHRVTNYVRILLEEADVQPTPLDLD---------DEL 1574
            |||.     ||..|..:.:.|||         :.|::  .|||..|...::.:         .||
Human    77 HRLQ-----ENFSLDLLKTAFVN---------SCYIK--SEEAKRQQLGIEKEAVLLNLKSNQEL 125

  Fly  1575 DMTELPHANKCISQEAE---KGVPPKG------------------------EFNMSTNVDVPKA- 1611
            .......:..|::|..|   ..:|.:|                        :..:|....||.| 
Human   126 SEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAV 190

  Fly  1612 LGDVLEALIAAV-------------------YLDCRDLQRTWEVI--FNLFEPELQEFTRKVPIN 1655
            |.....|:|.|:                   .:..::|...|::|  ..|...||::.....|.:
Human   191 LQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPES 255

  Fly  1656 HIRQLVEHKHAKPVF-------SSPIVE--GETVMVSCQFTCMEKTIKVYGFGSNKDQAKLSAAK 1711
            .:.:......|.|::       ...|.|  ||||:|:.:........|:|||..|:.....|..|
Human   256 RLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPK 320

  Fly  1712 HALQ 1715
            ..|:
Human   321 ETLR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-2NP_523778.2 DEXHc_dicer 6..204 CDD:350792
Dicer_PBD 241..343 CDD:277191
SF2_C_dicer 360..506 CDD:350189
Dicer_dimer 571..670 CDD:460900
PAZ 843..1004 CDD:198017
RIBOc 1194..1391 CDD:238333
RIBOc 1448..1649 CDD:238333 35/187 (19%)
dsrm 1653..1717 CDD:425434 18/72 (25%)
MRPL44NP_075066.1 Rnc <138..304 CDD:440336 28/165 (17%)
DSRM_MRPL44 225..307 CDD:380703 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.