DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcr-2 and Mrpl44

DIOPT Version :9

Sequence 1:NP_523778.2 Gene:Dcr-2 / 36993 FlyBaseID:FBgn0034246 Length:1722 Species:Drosophila melanogaster
Sequence 2:NP_001026820.1 Gene:Mrpl44 / 301552 RGDID:1309556 Length:332 Species:Rattus norvegicus


Alignment Length:268 Identity:54/268 - (20%)
Similarity:97/268 - (36%) Gaps:87/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1522 HFFILAENAKLSEIIS------KFVNFQESQGHRVTNYVRILLEEA-------DVQPTPLDLDDE 1573
            |..|.|..::|.|..|      .|||         :.|::  .|||       :.:...|:|.|.
  Rat    69 HAEIQAFGSRLQEAFSLDLLKTAFVN---------SCYIK--SEEAKRQNLGIEKEAALLNLKDN 122

  Fly  1574 LDMTE--LPHANKCISQEAE---KGVPPKG------------------------EFNMSTNVDVP 1609
            .::.|  |..:::|::|..|   ..:|.:|                        :..:|....||
  Rat   123 QELFEQGLSFSHRCLTQFLEDEFPNLPTEGIESLVNFLTGEAVVCHVASNLAVEQLTLSAEFPVP 187

  Fly  1610 -----KALGDVLEALI-------AAVY--------LDCRDLQRTWEVI--FNLFEPELQEFTRKV 1652
                 :....|:.||:       ||::        :..::|...|.::  ..|...||::.....
  Rat   188 QPVLRRTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTIVNPMGLLVEELKKRNISA 252

  Fly  1653 PINHIRQLVEHKHAKPVF-------SSPIVE--GETVMVSCQFTCMEKTIKVYGFGSNK---DQA 1705
            |.:.:.:......|.|::       ...|.|  ||||:|:.:........|:|||..|:   |.:
  Rat   253 PESRLTRQSGSTTALPLYFVGLYCDKRLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYS 317

  Fly  1706 KLSAAKHA 1713
            |...:..|
  Rat   318 KPKESSRA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dcr-2NP_523778.2 MPH1 6..542 CDD:224036
DEXDc 22..173 CDD:238005
Dicer_PBD 241..343 CDD:277191
HELICc <438..495 CDD:197757
Dicer_dimer 572..665 CDD:281376
PAZ 843..1004 CDD:198017
RIBOc 1194..1391 CDD:238333
Rnc 1433..1719 CDD:223644 54/268 (20%)
RIBOc 1448..1649 CDD:238333 36/190 (19%)
dsrm 1653..1717 CDD:278464 18/73 (25%)
Mrpl44NP_001026820.1 DSRM 236..304 CDD:294045 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.