DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and YPT31

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_010948.1 Gene:YPT31 / 856753 SGDID:S000000833 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:89/188 - (47%)
Similarity:122/188 - (64%) Gaps:3/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            ||.|||.::||.:|.|||.||..|.:::|..||..||||||.:|.:.:.||.:|.||||||||||
Yeast    10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQER 74

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFL 134
            :|::|.:|||||.|||:|||.:...|:....:||::.|..|..|:.:.|:|||.||...|.|...
Yeast    75 YRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTE 139

  Fly   135 EASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYGGA 192
            |:.||||||:|:|.||||...|||::||.:...||..|:...::|   :|.....|.|
Yeast   140 ESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMD---LGDSSANGNA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 79/159 (50%)
YPT31NP_010948.1 Rab11_like 11..175 CDD:206660 82/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.