DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RAB18

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_175056.1 Gene:RAB18 / 840987 AraportID:AT1G43890 Length:212 Species:Arabidopsis thaliana


Alignment Length:185 Identity:89/185 - (48%)
Similarity:115/185 - (62%) Gaps:8/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            :|||||.|:||.:|.|||.||..|..:.| ||.|.||||:|..:.:.:|.|.:||.|||||||||
plant    10 FDYLFKVLLIGDSGVGKSSLLLSFTSNTF-DDLSPTIGVDFKVKYLTIGEKKLKLAIWDTAGQER 73

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTN-WLNDARTLASPN--IVILLVGNKKDLEEARDV 131
            ||::|.||||||.|.::|||.|.||:|..|:: |..:. .|.|.|  .:.:|||||.|.|..|.|
plant    74 FRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEI-DLYSTNQDCIKMLVGNKVDKESERAV 137

  Fly   132 TFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSG 186
            :..|...||:|...:|||.||||..|||:.|   .:.:|..:||..|..|....|
plant   138 SKKEGIDFAREYGCLFLECSAKTRVNVEQCF---EELVLKILETPSLTAEGSSGG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 80/162 (49%)
RAB18NP_175056.1 PLN03118 1..200 CDD:215587 89/185 (48%)

Return to query results.
Submit another query.