DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA3

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_171628.2 Gene:RABA3 / 839493 AraportID:AT1G01200 Length:237 Species:Arabidopsis thaliana


Alignment Length:224 Identity:92/224 - (41%)
Similarity:129/224 - (57%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            |.|..||:||.::||.:..||:.||..|..::|..||..||||||.:|.:.:.||.||.||||||
plant    21 MPEKIDYVFKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTA 85

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEA-R 129
            ||||:|:||.:|||||.||::|||.|.|.||:.:..|:.:.|..|..:.||:|||||.||... |
plant    86 GQERYRAVTSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLSVGKR 150

  Fly   130 DVTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI------------ETGELDPER 182
            .|...:|..||:...|.|.|.||.:|.||:|||.:..:.|.:::            .|.:||..|
plant   151 AVPTEDAVEFAETQRLFFSEVSALSGGNVDEAFFRLLEEIFSRVVVSRKAMESDGGATVKLDGSR 215

  Fly   183 IGSGIQYGGAALRNLQTRQRSINKPDCTC 211
            |.   ...|:.|.....::::    .|:|
plant   216 ID---VISGSDLETSNIKEQA----SCSC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 78/160 (49%)
RABA3NP_171628.2 Rab11_like 26..191 CDD:206660 80/164 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.