DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA1b

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_173136.1 Gene:RABA1b / 838263 AraportID:AT1G16920 Length:216 Species:Arabidopsis thaliana


Alignment Length:182 Identity:86/182 - (47%)
Similarity:117/182 - (64%) Gaps:5/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTA 65
            :.:.||||||.::||.:|.|||.||..|.:::|..:|..||||||.:|.:.|.||.||.||||||
plant     6 VEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTA 70

  Fly    66 GQERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARD 130
            ||||:|::|.:|||||.|||||||.|.|.:|..:..||.:.:....||||::|||||.||.....
plant    71 GQERYRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLRHLLA 135

  Fly   131 VTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTIL-----AKIETGE 177
            |...:..::|::..|.|:||||....|||:||.:....|.     .::|.||
plant   136 VPTEDGKSYAEQESLCFMETSALEATNVEDAFAEVLTQIYRITSKKQVEAGE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 78/159 (49%)
RABA1bNP_173136.1 Rab11_like 11..175 CDD:206660 81/163 (50%)

Return to query results.
Submit another query.