DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA2b

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_172221.1 Gene:RABA2b / 837253 AraportID:AT1G07410 Length:214 Species:Arabidopsis thaliana


Alignment Length:169 Identity:86/169 - (50%)
Similarity:114/169 - (67%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQER 69
            ||||||.::||.:|.|||.:|..|..::|..:|..||||||.:|.:.|.||:||.||||||||||
plant     9 YDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQER 73

  Fly    70 FRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFL 134
            :|::|.:|||||.|||||||.|.|.:|..:..||.:.|..|..||||::.|||.||...|.|...
plant    74 YRAITSAYYRGAVGALLVYDITKRQTFENVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSVADE 138

  Fly   135 EASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI 173
            :..:.|::..|.||||||....|:|:||    :|||::|
plant   139 DGRSLAEKEGLSFLETSALEATNIEKAF----QTILSEI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 78/159 (49%)
RABA2bNP_172221.1 PLN03110 1..214 CDD:178657 86/169 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.