DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA4C

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_199607.1 Gene:RABA4C / 834847 AraportID:AT5G47960 Length:223 Species:Arabidopsis thaliana


Alignment Length:172 Identity:85/172 - (49%)
Similarity:113/172 - (65%) Gaps:4/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAG 66
            ::..||:||.::||.:..|||.||..|..::|..:|..||||||.:|.:.:..|::|.|||||||
plant     9 NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIWDTAG 73

  Fly    67 QERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDV 131
            |||:|:||.:|||||.||:||||.|.|.||:.:..||.:.|..|..||||:|:|||.||...|.|
plant    74 QERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDLGTLRAV 138

  Fly   132 TFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI 173
            ...:|..|||...|.|:||||....|||.:||    |:|.:|
plant   139 PTEDAKEFAQRENLFFMETSALDSNNVEPSFL----TVLTEI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 80/159 (50%)
RABA4CNP_199607.1 Rab11_like 13..177 CDD:206660 85/168 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.