DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and RABA5a

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_199563.1 Gene:RABA5a / 834802 AraportID:AT5G47520 Length:221 Species:Arabidopsis thaliana


Alignment Length:189 Identity:85/189 - (44%)
Similarity:121/189 - (64%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERF 70
            |||||.::||.:..|||.||..|...:|..:|..||||||.::.:::.||.:|.|||||||||||
plant    12 DYLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAGQERF 76

  Fly    71 RSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135
            |:||.:|||||.|||||||.:.|.:|:::..|||:..|.:..|:|.:|||||.||::.|:|:..|
plant    77 RAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLKDLREVSTAE 141

  Fly   136 ASTFAQENELIFLETSAKTGENVEEAF---LK-----CSKTILAKIETGELDPERIGSG 186
            ....|:...|.|:||||....||..||   :|     .|:.:::..|..:.||..:.:|
plant   142 GKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQDPASLSNG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 78/167 (47%)
RABA5aNP_199563.1 Rab11_like 12..176 CDD:206660 80/163 (49%)
RAB 15..178 CDD:197555 77/162 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.