DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and GB2

DIOPT Version :9

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_195311.1 Gene:GB2 / 829740 AraportID:AT4G35860 Length:211 Species:Arabidopsis thaliana


Alignment Length:195 Identity:110/195 - (56%)
Similarity:139/195 - (71%) Gaps:5/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68
            :||||||::|||..|.||||||..|.:.:|:.....|||||||:|:|.|.|:.:|||||||||||
plant     2 SYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTVDGRPIKLQIWDTAGQE 66

  Fly    69 RFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTF 133
            .|||:||||||||||||||||.|.|::||.|.:||.|||..|:||:.|:|:|||.||...|.|:.
plant    67 SFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMSIMLIGNKCDLAHKRAVSK 131

  Fly   134 LEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDPERIGSGIQYG-----GAA 193
            .|...||:|:.|:|||.||:|.:||||||::.:..||..|:.|..|.....|||:.|     |||
plant   132 EEGQQFAKEHGLLFLEASARTAQNVEEAFIETAAKILQNIQDGVFDVSNESSGIKIGYGRTQGAA 196

  Fly   194  193
            plant   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 94/159 (59%)
GB2NP_195311.1 PLN03108 1..210 CDD:178655 110/195 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.