DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab4 and ARA7

DIOPT Version :10

Sequence 1:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_193699.1 Gene:ARA7 / 827706 AraportID:AT4G19640 Length:200 Species:Arabidopsis thaliana


Alignment Length:178 Identity:76/178 - (42%)
Similarity:115/178 - (64%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERFRSVT 74
            |.:::|..|:|||.|:..|::.:|.:....|||..|.|:.:.|...:||.:|||||||||:.|:.
plant    12 KLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLA 76

  Fly    75 RSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLEASTF 139
            ..||||||.|::|:|.|::.||.....|:.:.:...:||:|:.|.|||.||.:||.||..:|.|:
plant    77 PMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTY 141

  Fly   140 AQENELIFLETSAKTGENVEEAFLKCSKTILAKIE-----TGELDPER 182
            ||||.|.|:||||||..||:|.|.:.::. |.:::     ||.:.|:|
plant   142 AQENGLFFMETSAKTATNVKEIFYEIARR-LPRVQPTENPTGMVLPDR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab4NP_523777.1 Rab4 9..169 CDD:206696 71/158 (45%)
ARA7NP_193699.1 Rab5_related 10..172 CDD:206653 71/160 (44%)

Return to query results.
Submit another query.